Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N5WV88

Protein Details
Accession A0A5N5WV88    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
56-81MQIFKDKEKAWKKRKESLQKRVHLVLHydrophilic
NLS Segment(s)
PositionSequence
63-71EKAWKKRKE
Subcellular Location(s) cyto 13.5, cyto_nucl 12.5, nucl 8.5, mito 3
Family & Domain DBs
Amino Acid Sequences MRFAKGSRPVVGEWEVAEEHHKASERGDAAGCWPLAPFPRYDSNGRELRCLFGREMQIFKDKEKAWKKRKESLQKRVHLVLGKQWFETLSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.19
3 0.16
4 0.18
5 0.14
6 0.12
7 0.14
8 0.15
9 0.12
10 0.13
11 0.18
12 0.17
13 0.18
14 0.17
15 0.15
16 0.15
17 0.18
18 0.17
19 0.11
20 0.1
21 0.1
22 0.12
23 0.13
24 0.12
25 0.12
26 0.17
27 0.2
28 0.23
29 0.24
30 0.28
31 0.32
32 0.32
33 0.31
34 0.27
35 0.26
36 0.25
37 0.25
38 0.19
39 0.19
40 0.23
41 0.22
42 0.23
43 0.22
44 0.27
45 0.26
46 0.26
47 0.29
48 0.27
49 0.35
50 0.44
51 0.53
52 0.56
53 0.65
54 0.71
55 0.73
56 0.82
57 0.84
58 0.85
59 0.85
60 0.85
61 0.83
62 0.82
63 0.75
64 0.7
65 0.63
66 0.54
67 0.52
68 0.51
69 0.45
70 0.39
71 0.37