Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N5WIF3

Protein Details
Accession A0A5N5WIF3    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
6-37TIQRRRSDSARSKSQQRNRRRRHLLLKTFEYCHydrophilic
NLS Segment(s)
PositionSequence
9-27RRRSDSARSKSQQRNRRRR
Subcellular Location(s) mito_nucl 12.333, nucl 11.5, mito 11, cyto_nucl 8.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR002100  TF_MADSbox  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
GO:0006351  P:DNA-templated transcription  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
PROSITE View protein in PROSITE  
PS50066  MADS_BOX_2  
Amino Acid Sequences MAAKRTIQRRRSDSARSKSQQRNRRRRHLLLKTFEYCKECDADVSITIRLRHNGQIFFFNSDGGWHLSQKELAMYYPKPKEVTWQELAAQYKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.76
3 0.72
4 0.76
5 0.79
6 0.81
7 0.8
8 0.81
9 0.83
10 0.82
11 0.88
12 0.87
13 0.86
14 0.87
15 0.89
16 0.87
17 0.84
18 0.81
19 0.74
20 0.68
21 0.61
22 0.53
23 0.42
24 0.34
25 0.27
26 0.2
27 0.16
28 0.15
29 0.12
30 0.11
31 0.12
32 0.12
33 0.12
34 0.13
35 0.14
36 0.13
37 0.14
38 0.18
39 0.2
40 0.2
41 0.2
42 0.23
43 0.24
44 0.26
45 0.24
46 0.19
47 0.16
48 0.14
49 0.15
50 0.13
51 0.13
52 0.11
53 0.11
54 0.12
55 0.13
56 0.13
57 0.12
58 0.1
59 0.11
60 0.15
61 0.17
62 0.24
63 0.27
64 0.3
65 0.31
66 0.3
67 0.39
68 0.42
69 0.47
70 0.43
71 0.42
72 0.41
73 0.45