Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N5WGW3

Protein Details
Accession A0A5N5WGW3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MKLPWRRKKKTKNQREHPCPYTAHydrophilic
NLS Segment(s)
PositionSequence
6-12RRKKKTK
Subcellular Location(s) mito 25
Family & Domain DBs
Amino Acid Sequences MKLPWRRKKKTKNQREHPCPYTATMAIFLNKDIPSASQNEASLACPPAFTYFQYVSCCGTWIIILSSSFRQT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.96
2 0.95
3 0.92
4 0.85
5 0.78
6 0.68
7 0.59
8 0.52
9 0.41
10 0.31
11 0.24
12 0.21
13 0.18
14 0.17
15 0.14
16 0.13
17 0.12
18 0.12
19 0.1
20 0.1
21 0.1
22 0.12
23 0.14
24 0.12
25 0.12
26 0.13
27 0.13
28 0.13
29 0.13
30 0.12
31 0.1
32 0.09
33 0.09
34 0.12
35 0.12
36 0.12
37 0.16
38 0.16
39 0.19
40 0.22
41 0.23
42 0.22
43 0.22
44 0.22
45 0.17
46 0.15
47 0.13
48 0.11
49 0.12
50 0.12
51 0.12
52 0.14