Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N5WL88

Protein Details
Accession A0A5N5WL88    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MRAPWKSHKKSIRQKTDRRKRGLMKKASEYBasic
NLS Segment(s)
PositionSequence
6-26KSHKKSIRQKTDRRKRGLMKK
Subcellular Location(s) nucl 23.5, mito_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR002100  TF_MADSbox  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
GO:0006351  P:DNA-templated transcription  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00319  SRF-TF  
PROSITE View protein in PROSITE  
PS50066  MADS_BOX_2  
Amino Acid Sequences MRAPWKSHKKSIRQKTDRRKRGLMKKASEYSRMCGADVFVGIRLRESGRLYTLLAETSEFWSSFVSQLDSYYPIPIHRTDKDFDIIHEAGEDDPLDCPTKEADTEKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.92
3 0.94
4 0.93
5 0.9
6 0.88
7 0.87
8 0.87
9 0.86
10 0.84
11 0.8
12 0.79
13 0.79
14 0.73
15 0.7
16 0.61
17 0.54
18 0.52
19 0.45
20 0.36
21 0.28
22 0.25
23 0.18
24 0.17
25 0.14
26 0.09
27 0.09
28 0.09
29 0.09
30 0.1
31 0.09
32 0.12
33 0.13
34 0.12
35 0.12
36 0.13
37 0.13
38 0.13
39 0.12
40 0.1
41 0.09
42 0.08
43 0.08
44 0.08
45 0.09
46 0.08
47 0.08
48 0.08
49 0.09
50 0.09
51 0.09
52 0.09
53 0.08
54 0.09
55 0.1
56 0.12
57 0.12
58 0.12
59 0.12
60 0.11
61 0.14
62 0.16
63 0.21
64 0.22
65 0.25
66 0.25
67 0.28
68 0.32
69 0.3
70 0.28
71 0.3
72 0.26
73 0.22
74 0.21
75 0.19
76 0.14
77 0.14
78 0.14
79 0.07
80 0.08
81 0.09
82 0.12
83 0.11
84 0.12
85 0.13
86 0.15
87 0.18