Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N5WTC9

Protein Details
Accession A0A5N5WTC9    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
91-110GEEEKEEKEKEKKKEEKEKEAcidic
NLS Segment(s)
PositionSequence
97-110EKEKEKKKEEKEKE
Subcellular Location(s) mito 10.5, mito_nucl 10.333, nucl 9, cyto_nucl 8.333, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MKNTITSLLIVTMSLFPLSLAAPKGTSEDMSKDTSKDTSKGKTDDKPGDEFDKVGYLAYSCAEVSDTYDDFRKCITIEIKSILEGLEIKAGEEEKEEKEKEKKKEEKEKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.06
4 0.07
5 0.07
6 0.08
7 0.09
8 0.09
9 0.1
10 0.1
11 0.12
12 0.12
13 0.13
14 0.13
15 0.14
16 0.16
17 0.2
18 0.2
19 0.19
20 0.2
21 0.22
22 0.22
23 0.23
24 0.24
25 0.26
26 0.3
27 0.34
28 0.37
29 0.39
30 0.44
31 0.47
32 0.46
33 0.43
34 0.41
35 0.39
36 0.35
37 0.3
38 0.22
39 0.17
40 0.14
41 0.11
42 0.09
43 0.06
44 0.06
45 0.06
46 0.06
47 0.04
48 0.04
49 0.05
50 0.05
51 0.06
52 0.09
53 0.09
54 0.09
55 0.14
56 0.14
57 0.13
58 0.14
59 0.13
60 0.11
61 0.16
62 0.18
63 0.17
64 0.19
65 0.22
66 0.22
67 0.22
68 0.22
69 0.17
70 0.14
71 0.12
72 0.1
73 0.11
74 0.1
75 0.1
76 0.11
77 0.12
78 0.11
79 0.13
80 0.15
81 0.15
82 0.22
83 0.23
84 0.28
85 0.38
86 0.46
87 0.52
88 0.6
89 0.66
90 0.7