Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N5X424

Protein Details
Accession A0A5N5X424    Localization Confidence Low Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
79-110KRLCDGCKPVRRKNRVYIICSKNPKHKQRQGKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20.5, cyto_mito 11.333, nucl 4.5, cyto_nucl 3.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR000473  Ribosomal_L36  
IPR035977  Ribosomal_L36_sp  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00444  Ribosomal_L36  
PROSITE View protein in PROSITE  
PS00828  RIBOSOMAL_L36  
Amino Acid Sequences MVSFRSIIGPSTGLFRQFLRKPLSGGFLSRSFSQLASLSLTNGLRSLRSGKEQAGSVAVSSTVRQLDQVRGMKTRSSVKRLCDGCKPVRRKNRVYIICSKNPKHKQRQGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.18
3 0.24
4 0.27
5 0.34
6 0.35
7 0.36
8 0.36
9 0.38
10 0.41
11 0.34
12 0.32
13 0.29
14 0.25
15 0.26
16 0.25
17 0.24
18 0.19
19 0.18
20 0.18
21 0.14
22 0.13
23 0.13
24 0.12
25 0.11
26 0.13
27 0.13
28 0.11
29 0.12
30 0.11
31 0.08
32 0.09
33 0.13
34 0.12
35 0.15
36 0.16
37 0.16
38 0.18
39 0.18
40 0.17
41 0.15
42 0.13
43 0.1
44 0.08
45 0.07
46 0.06
47 0.06
48 0.07
49 0.06
50 0.06
51 0.08
52 0.09
53 0.11
54 0.18
55 0.23
56 0.24
57 0.26
58 0.27
59 0.26
60 0.28
61 0.36
62 0.34
63 0.37
64 0.39
65 0.41
66 0.48
67 0.51
68 0.51
69 0.5
70 0.52
71 0.54
72 0.6
73 0.64
74 0.66
75 0.73
76 0.78
77 0.77
78 0.79
79 0.8
80 0.79
81 0.78
82 0.78
83 0.76
84 0.77
85 0.79
86 0.75
87 0.75
88 0.77
89 0.81
90 0.82