Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N5WTW1

Protein Details
Accession A0A5N5WTW1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
27-47INPLKWLKSRQSRNRHDKASRHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 12, plas 6, E.R. 3, mito 2, pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MALSTEVNITIIFGVLATIVGILTWWINPLKWLKSRQSRNRHDKASRSRDPTLPEGSSGNTEIQLEEGIFRYHYMSKPSGSNGILSRHAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.04
4 0.03
5 0.03
6 0.03
7 0.03
8 0.03
9 0.03
10 0.03
11 0.03
12 0.05
13 0.06
14 0.06
15 0.09
16 0.13
17 0.18
18 0.23
19 0.28
20 0.35
21 0.44
22 0.55
23 0.62
24 0.69
25 0.75
26 0.8
27 0.82
28 0.81
29 0.76
30 0.75
31 0.76
32 0.74
33 0.71
34 0.67
35 0.62
36 0.57
37 0.56
38 0.51
39 0.45
40 0.36
41 0.3
42 0.25
43 0.22
44 0.21
45 0.18
46 0.15
47 0.11
48 0.11
49 0.1
50 0.09
51 0.09
52 0.07
53 0.07
54 0.08
55 0.08
56 0.08
57 0.08
58 0.1
59 0.14
60 0.16
61 0.2
62 0.22
63 0.24
64 0.26
65 0.29
66 0.32
67 0.29
68 0.31
69 0.29
70 0.31