Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N5XH27

Protein Details
Accession A0A5N5XH27    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
75-99VSSSEKSTRLQKRRKISREKPVDEGHydrophilic
NLS Segment(s)
PositionSequence
88-88R
Subcellular Location(s) mito 10.5, mito_nucl 9.499, cyto_nucl 8.833, cyto 7.5, nucl 7
Family & Domain DBs
Amino Acid Sequences MASLKRAIAVIGPPYIGRMAAYVVRDLQILRSLYYRDDEVAVEVQYGLYPFERSQVEEELDNDADDNEENDYKEVSSSEKSTRLQKRRKISREKPVDEGVLLGGGVQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.13
4 0.1
5 0.08
6 0.09
7 0.11
8 0.12
9 0.12
10 0.12
11 0.13
12 0.13
13 0.12
14 0.12
15 0.14
16 0.14
17 0.14
18 0.15
19 0.15
20 0.16
21 0.17
22 0.16
23 0.12
24 0.12
25 0.11
26 0.11
27 0.11
28 0.1
29 0.09
30 0.08
31 0.07
32 0.06
33 0.06
34 0.05
35 0.04
36 0.06
37 0.05
38 0.09
39 0.09
40 0.1
41 0.12
42 0.13
43 0.13
44 0.13
45 0.14
46 0.13
47 0.13
48 0.12
49 0.1
50 0.08
51 0.07
52 0.07
53 0.07
54 0.06
55 0.07
56 0.07
57 0.08
58 0.08
59 0.08
60 0.08
61 0.08
62 0.09
63 0.11
64 0.14
65 0.16
66 0.21
67 0.24
68 0.33
69 0.43
70 0.51
71 0.58
72 0.63
73 0.71
74 0.77
75 0.85
76 0.87
77 0.86
78 0.87
79 0.89
80 0.85
81 0.8
82 0.74
83 0.65
84 0.54
85 0.45
86 0.35
87 0.24