Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179UQL8

Protein Details
Accession A0A179UQL8   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
114-138GMVGMKRRDRSGRKKGKGKGGKGKABasic
NLS Segment(s)
PositionSequence
119-138KRRDRSGRKKGKGKGGKGKA
Subcellular Location(s) mito 17.5, cyto_mito 11.333, cyto 4, cyto_nucl 3.833, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR003210  Signal_recog_particle_SRP14  
IPR009018  Signal_recog_particle_SRP9/14  
Gene Ontology GO:0005786  C:signal recognition particle, endoplasmic reticulum targeting  
GO:0008312  F:7S RNA binding  
GO:0030942  F:endoplasmic reticulum signal peptide binding  
GO:0006614  P:SRP-dependent cotranslational protein targeting to membrane  
KEGG bgh:BDBG_05139  -  
Pfam View protein in Pfam  
PF02290  SRP14  
Amino Acid Sequences MSSPHVSNDEFFTALKALLTTQSTKARGSIFLTQKRLPPFGTTPITTTTTTSSSSSQSEATPSISASPALAPVPVLVRATNGRHKEAKSKVSTVVQPDDIEGFFVRYAEVCKMGMVGMKRRDRSGRKKGKGKGGKGKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.14
3 0.11
4 0.09
5 0.11
6 0.14
7 0.14
8 0.19
9 0.25
10 0.26
11 0.27
12 0.29
13 0.27
14 0.27
15 0.28
16 0.32
17 0.35
18 0.4
19 0.45
20 0.45
21 0.48
22 0.5
23 0.48
24 0.4
25 0.36
26 0.32
27 0.33
28 0.35
29 0.31
30 0.29
31 0.3
32 0.32
33 0.27
34 0.25
35 0.21
36 0.18
37 0.19
38 0.19
39 0.16
40 0.15
41 0.16
42 0.16
43 0.15
44 0.13
45 0.13
46 0.12
47 0.12
48 0.1
49 0.1
50 0.09
51 0.09
52 0.08
53 0.07
54 0.06
55 0.06
56 0.06
57 0.05
58 0.04
59 0.05
60 0.05
61 0.06
62 0.06
63 0.05
64 0.07
65 0.09
66 0.13
67 0.2
68 0.21
69 0.25
70 0.28
71 0.3
72 0.37
73 0.4
74 0.45
75 0.42
76 0.42
77 0.41
78 0.41
79 0.43
80 0.39
81 0.36
82 0.3
83 0.26
84 0.25
85 0.23
86 0.18
87 0.17
88 0.12
89 0.1
90 0.08
91 0.08
92 0.08
93 0.07
94 0.09
95 0.1
96 0.11
97 0.1
98 0.1
99 0.1
100 0.11
101 0.13
102 0.15
103 0.21
104 0.29
105 0.36
106 0.38
107 0.43
108 0.53
109 0.59
110 0.67
111 0.7
112 0.73
113 0.75
114 0.83
115 0.86
116 0.88
117 0.88
118 0.87