Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179UNT9

Protein Details
Accession A0A179UNT9    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
60-81MIIISDEKEKKKKKKKKKKNEKBasic
NLS Segment(s)
PositionSequence
67-81KEKKKKKKKKKKNEK
Subcellular Location(s) nucl 17, cyto_nucl 14, cyto 9
Family & Domain DBs
Amino Acid Sequences MIQNIEKTALLSERVNLLATEMEPETADQKIWDFKMQVDLAEKKQQKPSSEKAVKRDFEMIIISDEKEKKKKKKKKKKNEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.14
4 0.13
5 0.11
6 0.11
7 0.12
8 0.09
9 0.09
10 0.09
11 0.09
12 0.09
13 0.09
14 0.09
15 0.07
16 0.08
17 0.11
18 0.12
19 0.13
20 0.12
21 0.12
22 0.18
23 0.18
24 0.18
25 0.18
26 0.2
27 0.2
28 0.28
29 0.3
30 0.27
31 0.34
32 0.37
33 0.37
34 0.41
35 0.44
36 0.47
37 0.54
38 0.55
39 0.57
40 0.62
41 0.59
42 0.55
43 0.53
44 0.42
45 0.35
46 0.32
47 0.24
48 0.19
49 0.19
50 0.17
51 0.19
52 0.23
53 0.27
54 0.35
55 0.44
56 0.52
57 0.63
58 0.73
59 0.79
60 0.86
61 0.92