Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179UGG9

Protein Details
Accession A0A179UGG9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
389-422RKLLFNGVRRHYKSKPRKKVPKRPEECPPCERKYBasic
NLS Segment(s)
PositionSequence
397-411RRHYKSKPRKKVPKR
Subcellular Location(s) extr 17, cyto 5.5, cyto_nucl 3.5, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR034193  PCSK9_ProteinaseK-like  
IPR000209  Peptidase_S8/S53_dom  
IPR036852  Peptidase_S8/S53_dom_sf  
IPR023827  Peptidase_S8_Asp-AS  
IPR022398  Peptidase_S8_His-AS  
IPR023828  Peptidase_S8_Ser-AS  
IPR015500  Peptidase_S8_subtilisin-rel  
IPR010259  S8pro/Inhibitor_I9  
IPR037045  S8pro/Inhibitor_I9_sf  
Gene Ontology GO:0005576  C:extracellular region  
GO:0004252  F:serine-type endopeptidase activity  
GO:0006508  P:proteolysis  
KEGG bgh:BDBG_03231  -  
Pfam View protein in Pfam  
PF05922  Inhibitor_I9  
PF00082  Peptidase_S8  
PROSITE View protein in PROSITE  
PS51892  SUBTILASE  
PS00136  SUBTILASE_ASP  
PS00137  SUBTILASE_HIS  
PS00138  SUBTILASE_SER  
CDD cd04077  Peptidases_S8_PCSK9_ProteinaseK_like  
Amino Acid Sequences MHFFDTILPLALVVLSTADAAAVLKVPRNSHAVPNSYIVVMKPGTSDDRFESHRSWVSNKLSASDSGVDNGGVRHDYNLDSEFKAYSGIFGEDVIKQISNDEDVAYIEPDIVVKLDKLRIQKNASSWGLGRISSTKPGSPHYIYDEKAGEGITAYVIDTGIDVNHPDFDGRATWGTNTVDSRDEDCGNHGTHVAGTIGGNRHGVAKKIKLIGVKVFGCDEDGGGSNVIRGMAWAYAHATHNGDPKKSIMNMSLGAPYSRSFNEAAAAIVRAGIFLAVSAGNDGFDASKKSPASEPTVCTIGATDSEDTIAKFSNYGSGVDLFAPGVDIVSTVPGGKTDSYSGTSMAAPHAAGVAAYLMAIENISGGAVCDRLKELARDSVKGAPEGTTRKLLFNGVRRHYKSKPRKKVPKRPEECPPCERKYSY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.04
3 0.05
4 0.04
5 0.04
6 0.04
7 0.05
8 0.05
9 0.08
10 0.09
11 0.13
12 0.17
13 0.18
14 0.21
15 0.28
16 0.3
17 0.35
18 0.41
19 0.42
20 0.41
21 0.43
22 0.41
23 0.35
24 0.34
25 0.25
26 0.22
27 0.18
28 0.16
29 0.14
30 0.15
31 0.2
32 0.21
33 0.23
34 0.22
35 0.27
36 0.3
37 0.33
38 0.32
39 0.33
40 0.37
41 0.37
42 0.37
43 0.41
44 0.43
45 0.44
46 0.43
47 0.39
48 0.36
49 0.34
50 0.34
51 0.28
52 0.23
53 0.19
54 0.19
55 0.16
56 0.14
57 0.14
58 0.12
59 0.1
60 0.1
61 0.1
62 0.11
63 0.12
64 0.14
65 0.16
66 0.17
67 0.17
68 0.18
69 0.17
70 0.15
71 0.16
72 0.13
73 0.12
74 0.11
75 0.1
76 0.09
77 0.1
78 0.12
79 0.1
80 0.12
81 0.12
82 0.11
83 0.1
84 0.11
85 0.11
86 0.11
87 0.1
88 0.09
89 0.09
90 0.09
91 0.1
92 0.1
93 0.09
94 0.07
95 0.07
96 0.06
97 0.06
98 0.06
99 0.05
100 0.06
101 0.08
102 0.12
103 0.15
104 0.21
105 0.26
106 0.32
107 0.37
108 0.39
109 0.4
110 0.45
111 0.42
112 0.38
113 0.34
114 0.32
115 0.29
116 0.25
117 0.23
118 0.18
119 0.19
120 0.23
121 0.24
122 0.21
123 0.21
124 0.25
125 0.29
126 0.28
127 0.28
128 0.29
129 0.32
130 0.3
131 0.32
132 0.3
133 0.24
134 0.22
135 0.2
136 0.14
137 0.09
138 0.09
139 0.06
140 0.05
141 0.04
142 0.04
143 0.04
144 0.04
145 0.04
146 0.04
147 0.04
148 0.04
149 0.04
150 0.04
151 0.05
152 0.05
153 0.05
154 0.05
155 0.06
156 0.06
157 0.07
158 0.08
159 0.08
160 0.08
161 0.11
162 0.12
163 0.13
164 0.12
165 0.12
166 0.13
167 0.14
168 0.16
169 0.15
170 0.16
171 0.14
172 0.16
173 0.17
174 0.15
175 0.15
176 0.13
177 0.11
178 0.1
179 0.1
180 0.08
181 0.06
182 0.05
183 0.07
184 0.08
185 0.08
186 0.09
187 0.08
188 0.12
189 0.12
190 0.15
191 0.16
192 0.17
193 0.21
194 0.23
195 0.24
196 0.22
197 0.23
198 0.23
199 0.25
200 0.23
201 0.19
202 0.18
203 0.15
204 0.15
205 0.13
206 0.1
207 0.06
208 0.07
209 0.07
210 0.06
211 0.06
212 0.05
213 0.06
214 0.06
215 0.04
216 0.04
217 0.04
218 0.04
219 0.05
220 0.05
221 0.05
222 0.07
223 0.08
224 0.09
225 0.1
226 0.11
227 0.18
228 0.2
229 0.19
230 0.18
231 0.19
232 0.21
233 0.21
234 0.2
235 0.16
236 0.16
237 0.16
238 0.17
239 0.18
240 0.15
241 0.14
242 0.13
243 0.12
244 0.12
245 0.11
246 0.12
247 0.1
248 0.1
249 0.11
250 0.11
251 0.11
252 0.09
253 0.09
254 0.07
255 0.07
256 0.06
257 0.05
258 0.05
259 0.04
260 0.03
261 0.03
262 0.04
263 0.03
264 0.03
265 0.04
266 0.04
267 0.04
268 0.04
269 0.05
270 0.04
271 0.05
272 0.09
273 0.09
274 0.15
275 0.15
276 0.17
277 0.19
278 0.22
279 0.28
280 0.29
281 0.3
282 0.28
283 0.29
284 0.27
285 0.24
286 0.22
287 0.15
288 0.12
289 0.12
290 0.1
291 0.08
292 0.09
293 0.1
294 0.1
295 0.1
296 0.1
297 0.08
298 0.07
299 0.07
300 0.11
301 0.12
302 0.12
303 0.13
304 0.13
305 0.14
306 0.14
307 0.14
308 0.09
309 0.08
310 0.08
311 0.06
312 0.05
313 0.04
314 0.04
315 0.04
316 0.05
317 0.05
318 0.05
319 0.05
320 0.06
321 0.08
322 0.08
323 0.09
324 0.1
325 0.13
326 0.15
327 0.16
328 0.16
329 0.16
330 0.16
331 0.15
332 0.14
333 0.13
334 0.1
335 0.09
336 0.09
337 0.07
338 0.06
339 0.06
340 0.05
341 0.04
342 0.04
343 0.04
344 0.03
345 0.03
346 0.04
347 0.03
348 0.03
349 0.03
350 0.03
351 0.03
352 0.03
353 0.04
354 0.06
355 0.06
356 0.08
357 0.09
358 0.12
359 0.14
360 0.16
361 0.19
362 0.27
363 0.3
364 0.31
365 0.32
366 0.36
367 0.35
368 0.34
369 0.31
370 0.25
371 0.28
372 0.31
373 0.32
374 0.34
375 0.33
376 0.34
377 0.35
378 0.38
379 0.39
380 0.44
381 0.5
382 0.51
383 0.6
384 0.64
385 0.69
386 0.72
387 0.76
388 0.79
389 0.8
390 0.83
391 0.84
392 0.9
393 0.94
394 0.96
395 0.96
396 0.96
397 0.92
398 0.88
399 0.88
400 0.88
401 0.84
402 0.83
403 0.81
404 0.76