Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179UDD6

Protein Details
Accession A0A179UDD6    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
14-40ARQIRKSIAKAKERRDNPKKEFWLKKVHydrophilic
NLS Segment(s)
PositionSequence
15-33RQIRKSIAKAKERRDNPKK
Subcellular Location(s) mito 18, nucl 5, cyto 3
Family & Domain DBs
KEGG bgh:BDBG_02175  -  
Amino Acid Sequences MILTPASLRTELRARQIRKSIAKAKERRDNPKKEFWLKKVIVNFWLPLSSKIPFVNSIKEKHRERRAARGPFQPTPMPLEHGFAYAYATQNAPDQDPDTDRYSEESGRDSLVSDTSSVREDMFHLDGFDIVGNWREFERRMGASYN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.51
3 0.59
4 0.63
5 0.63
6 0.69
7 0.68
8 0.68
9 0.75
10 0.75
11 0.76
12 0.78
13 0.78
14 0.81
15 0.82
16 0.83
17 0.79
18 0.81
19 0.81
20 0.81
21 0.81
22 0.74
23 0.75
24 0.66
25 0.64
26 0.6
27 0.53
28 0.47
29 0.4
30 0.36
31 0.26
32 0.27
33 0.23
34 0.19
35 0.19
36 0.16
37 0.17
38 0.16
39 0.17
40 0.18
41 0.19
42 0.25
43 0.26
44 0.3
45 0.33
46 0.41
47 0.45
48 0.5
49 0.58
50 0.59
51 0.58
52 0.64
53 0.68
54 0.68
55 0.68
56 0.66
57 0.63
58 0.55
59 0.55
60 0.45
61 0.36
62 0.32
63 0.28
64 0.24
65 0.19
66 0.19
67 0.16
68 0.16
69 0.15
70 0.11
71 0.12
72 0.1
73 0.1
74 0.09
75 0.09
76 0.08
77 0.1
78 0.11
79 0.1
80 0.1
81 0.1
82 0.11
83 0.13
84 0.16
85 0.18
86 0.17
87 0.17
88 0.19
89 0.2
90 0.21
91 0.19
92 0.19
93 0.16
94 0.16
95 0.16
96 0.14
97 0.13
98 0.12
99 0.12
100 0.1
101 0.1
102 0.11
103 0.12
104 0.12
105 0.11
106 0.1
107 0.11
108 0.14
109 0.16
110 0.15
111 0.14
112 0.14
113 0.14
114 0.13
115 0.12
116 0.08
117 0.07
118 0.12
119 0.11
120 0.12
121 0.13
122 0.15
123 0.16
124 0.2
125 0.25
126 0.23