Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N5XIL4

Protein Details
Accession A0A5N5XIL4    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
7-39TSQTSRASKRRCMPKKPEKPKKPKIKKVSGLLAHydrophilic
NLS Segment(s)
PositionSequence
14-33SKRRCMPKKPEKPKKPKIKK
Subcellular Location(s) nucl 20, mito_nucl 13.333, cyto_nucl 11.333, mito 5.5
Family & Domain DBs
Amino Acid Sequences MESFMHTSQTSRASKRRCMPKKPEKPKKPKIKKVSGLLAQWPSPENVIFEPLIIKEYLSPQPILPSGVGRTL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.6
3 0.68
4 0.69
5 0.74
6 0.79
7 0.82
8 0.87
9 0.9
10 0.92
11 0.92
12 0.93
13 0.94
14 0.94
15 0.94
16 0.93
17 0.92
18 0.91
19 0.87
20 0.82
21 0.8
22 0.72
23 0.63
24 0.56
25 0.48
26 0.38
27 0.31
28 0.25
29 0.18
30 0.14
31 0.13
32 0.1
33 0.09
34 0.11
35 0.1
36 0.1
37 0.1
38 0.09
39 0.11
40 0.09
41 0.09
42 0.08
43 0.12
44 0.17
45 0.18
46 0.19
47 0.18
48 0.21
49 0.22
50 0.23
51 0.19
52 0.18