Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N5XAE8

Protein Details
Accession A0A5N5XAE8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
29-48LTTLRPRCWRGKKTNDLKIQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20.5, cyto_mito 12.333, cyto_nucl 3.333, cyto 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MVQLTVSGRHTRGLRCKCSVLIGAKTPRLTTLRPRCWRGKKTNDLKIQLKSISSTLSLSTWTDPLSSFLPSLVLPFGIFSPLLHALYPFFLTSPN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.52
3 0.54
4 0.5
5 0.51
6 0.49
7 0.44
8 0.39
9 0.4
10 0.4
11 0.41
12 0.4
13 0.37
14 0.35
15 0.32
16 0.3
17 0.34
18 0.39
19 0.46
20 0.52
21 0.58
22 0.64
23 0.71
24 0.77
25 0.76
26 0.76
27 0.76
28 0.78
29 0.82
30 0.79
31 0.76
32 0.71
33 0.63
34 0.56
35 0.46
36 0.37
37 0.29
38 0.22
39 0.16
40 0.13
41 0.11
42 0.09
43 0.09
44 0.09
45 0.09
46 0.09
47 0.09
48 0.09
49 0.09
50 0.08
51 0.1
52 0.11
53 0.11
54 0.1
55 0.09
56 0.1
57 0.1
58 0.1
59 0.08
60 0.07
61 0.06
62 0.07
63 0.07
64 0.07
65 0.08
66 0.06
67 0.11
68 0.13
69 0.14
70 0.13
71 0.13
72 0.13
73 0.15
74 0.17
75 0.12