Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N5WG76

Protein Details
Accession A0A5N5WG76    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
61-82VLAWRKEKPRPPTKRLVKAPGPHydrophilic
NLS Segment(s)
PositionSequence
46-80AAAKRVVRARAKESRVLAWRKEKPRPPTKRLVKAP
Subcellular Location(s) cyto 11, pero 6, nucl 5, mito 5, mito_nucl 5
Family & Domain DBs
Amino Acid Sequences MVSGQCYGIYTHVGIDGNEKADELAKAAAVRGPMPEEAKQMIRLGAAAKRVVRARAKESRVLAWRKEKPRPPTKRLVKAPGPQVLRYWKALRKATCSVLI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.15
3 0.15
4 0.15
5 0.15
6 0.14
7 0.12
8 0.13
9 0.13
10 0.1
11 0.09
12 0.08
13 0.08
14 0.08
15 0.09
16 0.09
17 0.09
18 0.08
19 0.1
20 0.11
21 0.13
22 0.14
23 0.15
24 0.16
25 0.17
26 0.17
27 0.16
28 0.15
29 0.12
30 0.11
31 0.11
32 0.11
33 0.12
34 0.12
35 0.12
36 0.14
37 0.15
38 0.19
39 0.22
40 0.23
41 0.28
42 0.34
43 0.37
44 0.39
45 0.39
46 0.41
47 0.44
48 0.45
49 0.44
50 0.45
51 0.51
52 0.54
53 0.61
54 0.63
55 0.66
56 0.72
57 0.77
58 0.74
59 0.77
60 0.8
61 0.81
62 0.82
63 0.81
64 0.78
65 0.76
66 0.76
67 0.72
68 0.66
69 0.57
70 0.54
71 0.52
72 0.47
73 0.46
74 0.45
75 0.43
76 0.48
77 0.54
78 0.54
79 0.54
80 0.56