Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179UVK7

Protein Details
Accession A0A179UVK7    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
255-274LDRERRKRRAWEWENALRRCBasic
NLS Segment(s)
Subcellular Location(s) cyto 9.5, cyto_nucl 8.5, cysk 8, nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038765  Papain-like_cys_pep_sf  
IPR001578  Peptidase_C12_UCH  
IPR036959  Peptidase_C12_UCH_sf  
IPR017390  Ubiquitinyl_hydrolase_UCH37  
IPR041507  UCH_C  
Gene Ontology GO:0004843  F:cysteine-type deubiquitinase activity  
GO:0016579  P:protein deubiquitination  
GO:0006511  P:ubiquitin-dependent protein catabolic process  
KEGG bgh:BDBG_07539  -  
Pfam View protein in Pfam  
PF01088  Peptidase_C12  
PF18031  UCH_C  
CDD cd09617  Peptidase_C12_UCH37_BAP1  
Amino Acid Sequences MTDAGGWSTIESDEGVFTSLIENLGVKDVQFEELISLDADTIRSLSPVYGVIFLFKWAGGQSRDSAAPQDGTYDRAATDNGLFFAAQTIQNACGTQAVLSVILNQDSLASQSSQAGIDIGPELRDFKDFTTGFPPDLRGEALSNSARIRASHNAFARASPFVDETSRPPVSEEDAELYHFIAYTPFNGVLYELDGLQPFPISHGSCDESSFPEKVIEVLQRRIARYPEGEIRFNLMAVVRDLRVRALEIGDVEMLDRERRKRRAWEWENALRRCNFVGFIGEVAKGVVGMKVKEGEESYNKWIEGARKETQRRLEMRRGRGGGGDLD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.09
3 0.08
4 0.08
5 0.08
6 0.09
7 0.09
8 0.09
9 0.09
10 0.08
11 0.11
12 0.11
13 0.09
14 0.11
15 0.12
16 0.13
17 0.13
18 0.12
19 0.11
20 0.11
21 0.12
22 0.09
23 0.08
24 0.07
25 0.07
26 0.08
27 0.07
28 0.07
29 0.07
30 0.07
31 0.07
32 0.07
33 0.08
34 0.09
35 0.1
36 0.11
37 0.11
38 0.13
39 0.12
40 0.13
41 0.13
42 0.11
43 0.1
44 0.09
45 0.13
46 0.13
47 0.15
48 0.16
49 0.18
50 0.2
51 0.19
52 0.21
53 0.18
54 0.18
55 0.16
56 0.18
57 0.16
58 0.17
59 0.18
60 0.16
61 0.14
62 0.14
63 0.14
64 0.11
65 0.12
66 0.11
67 0.11
68 0.1
69 0.1
70 0.09
71 0.1
72 0.1
73 0.09
74 0.09
75 0.1
76 0.11
77 0.11
78 0.12
79 0.1
80 0.09
81 0.09
82 0.08
83 0.08
84 0.07
85 0.07
86 0.07
87 0.08
88 0.07
89 0.07
90 0.07
91 0.06
92 0.06
93 0.06
94 0.07
95 0.07
96 0.06
97 0.07
98 0.07
99 0.08
100 0.08
101 0.08
102 0.07
103 0.06
104 0.06
105 0.06
106 0.06
107 0.06
108 0.06
109 0.07
110 0.07
111 0.09
112 0.09
113 0.09
114 0.17
115 0.17
116 0.18
117 0.23
118 0.23
119 0.23
120 0.23
121 0.24
122 0.16
123 0.17
124 0.15
125 0.1
126 0.1
127 0.1
128 0.13
129 0.12
130 0.12
131 0.12
132 0.13
133 0.12
134 0.12
135 0.15
136 0.18
137 0.21
138 0.26
139 0.27
140 0.29
141 0.29
142 0.29
143 0.27
144 0.21
145 0.18
146 0.13
147 0.12
148 0.09
149 0.1
150 0.11
151 0.11
152 0.17
153 0.17
154 0.16
155 0.16
156 0.16
157 0.18
158 0.17
159 0.16
160 0.11
161 0.11
162 0.12
163 0.11
164 0.1
165 0.08
166 0.07
167 0.06
168 0.05
169 0.05
170 0.06
171 0.07
172 0.07
173 0.07
174 0.07
175 0.07
176 0.06
177 0.07
178 0.07
179 0.05
180 0.06
181 0.06
182 0.06
183 0.06
184 0.06
185 0.05
186 0.06
187 0.08
188 0.08
189 0.09
190 0.11
191 0.14
192 0.14
193 0.15
194 0.15
195 0.15
196 0.18
197 0.17
198 0.15
199 0.14
200 0.13
201 0.13
202 0.15
203 0.18
204 0.18
205 0.21
206 0.26
207 0.28
208 0.29
209 0.32
210 0.31
211 0.28
212 0.26
213 0.28
214 0.31
215 0.32
216 0.33
217 0.3
218 0.33
219 0.3
220 0.28
221 0.24
222 0.16
223 0.13
224 0.13
225 0.14
226 0.11
227 0.12
228 0.12
229 0.12
230 0.12
231 0.12
232 0.11
233 0.1
234 0.11
235 0.1
236 0.11
237 0.1
238 0.09
239 0.08
240 0.09
241 0.09
242 0.11
243 0.15
244 0.22
245 0.31
246 0.38
247 0.44
248 0.53
249 0.6
250 0.68
251 0.71
252 0.73
253 0.73
254 0.77
255 0.8
256 0.73
257 0.7
258 0.6
259 0.55
260 0.46
261 0.38
262 0.29
263 0.21
264 0.22
265 0.17
266 0.18
267 0.17
268 0.15
269 0.14
270 0.13
271 0.11
272 0.08
273 0.08
274 0.08
275 0.09
276 0.1
277 0.12
278 0.15
279 0.15
280 0.18
281 0.19
282 0.22
283 0.25
284 0.29
285 0.33
286 0.33
287 0.33
288 0.31
289 0.33
290 0.34
291 0.36
292 0.38
293 0.41
294 0.47
295 0.54
296 0.61
297 0.66
298 0.68
299 0.69
300 0.71
301 0.74
302 0.73
303 0.75
304 0.78
305 0.71
306 0.64
307 0.59