Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N5WQD6

Protein Details
Accession A0A5N5WQD6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
63-82LRNTQDKRARKLAKKRLGTFHydrophilic
NLS Segment(s)
PositionSequence
69-88KRARKLAKKRLGTFGRGKRK
Subcellular Location(s) mito 18.5, mito_nucl 11.833, cyto_nucl 4.833, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038097  L36e_sf  
IPR000509  Ribosomal_L36e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01158  Ribosomal_L36e  
PROSITE View protein in PROSITE  
PS01190  RIBOSOMAL_L36E  
Amino Acid Sequences MAQERSGIVVGLNKGHKTTPFQTPKNRVSRTKGQSSRRTAFVRDIAREVVGLAPYERRIIELLRNTQDKRARKLAKKRLGTFGRGKRKVEDMQRVIAESRRVTGH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.23
3 0.25
4 0.27
5 0.3
6 0.36
7 0.42
8 0.48
9 0.57
10 0.64
11 0.7
12 0.73
13 0.76
14 0.71
15 0.69
16 0.73
17 0.7
18 0.72
19 0.72
20 0.71
21 0.73
22 0.76
23 0.71
24 0.68
25 0.63
26 0.54
27 0.5
28 0.47
29 0.42
30 0.35
31 0.33
32 0.27
33 0.25
34 0.23
35 0.19
36 0.13
37 0.09
38 0.07
39 0.06
40 0.06
41 0.07
42 0.08
43 0.07
44 0.07
45 0.08
46 0.09
47 0.14
48 0.18
49 0.22
50 0.26
51 0.3
52 0.3
53 0.36
54 0.43
55 0.43
56 0.44
57 0.49
58 0.54
59 0.59
60 0.69
61 0.74
62 0.76
63 0.8
64 0.78
65 0.78
66 0.74
67 0.71
68 0.7
69 0.7
70 0.71
71 0.68
72 0.65
73 0.59
74 0.61
75 0.62
76 0.62
77 0.62
78 0.55
79 0.56
80 0.55
81 0.53
82 0.48
83 0.45
84 0.4
85 0.31