Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179UAA6

Protein Details
Accession A0A179UAA6    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
241-279PEWNKKDRFAAWRRRMERRKIAAQLKDAKSKRKGKKNKABasic
NLS Segment(s)
PositionSequence
244-279NKKDRFAAWRRRMERRKIAAQLKDAKSKRKGKKNKA
Subcellular Location(s) mito 21, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001684  Ribosomal_L27  
IPR018261  Ribosomal_L27_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG bgh:BDBG_01277  -  
Pfam View protein in Pfam  
PF01016  Ribosomal_L27  
PROSITE View protein in PROSITE  
PS00831  RIBOSOMAL_L27  
Amino Acid Sequences MIQPQFRTQLRVLDSLFLPSTSLLCNQQSTRSLSHLSRRTARSLSGTALSPPSTSRSSILLLQQQRPPQFPSRTTIHQTQLQVRYASHATQGRANNGTKNGAGRRLGAKKSGDQYVIPGNIIFRQRGSKWFPGENCGMGRDHTIYSLATGYVKYYTDPARHPDRKYIGVAFDKSDKFPLPRNAITKRRLGMVAVPRDIEQEKANKAAKEAEIVPTLRPGYMYRVANWQIGRVAERAGVKVPEWNKKDRFAAWRRRMERRKIAAQLKDAKSKRKGKKNKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.33
3 0.31
4 0.24
5 0.21
6 0.16
7 0.16
8 0.14
9 0.16
10 0.16
11 0.17
12 0.22
13 0.22
14 0.28
15 0.31
16 0.34
17 0.34
18 0.33
19 0.36
20 0.36
21 0.44
22 0.46
23 0.48
24 0.52
25 0.53
26 0.55
27 0.52
28 0.5
29 0.46
30 0.41
31 0.37
32 0.31
33 0.29
34 0.25
35 0.25
36 0.23
37 0.18
38 0.17
39 0.18
40 0.18
41 0.18
42 0.18
43 0.18
44 0.19
45 0.22
46 0.25
47 0.29
48 0.32
49 0.36
50 0.39
51 0.43
52 0.44
53 0.43
54 0.44
55 0.44
56 0.45
57 0.42
58 0.42
59 0.42
60 0.45
61 0.48
62 0.49
63 0.44
64 0.44
65 0.46
66 0.48
67 0.48
68 0.45
69 0.4
70 0.35
71 0.34
72 0.31
73 0.28
74 0.25
75 0.24
76 0.21
77 0.27
78 0.29
79 0.28
80 0.31
81 0.31
82 0.29
83 0.27
84 0.28
85 0.23
86 0.25
87 0.24
88 0.24
89 0.23
90 0.22
91 0.27
92 0.32
93 0.32
94 0.32
95 0.32
96 0.32
97 0.35
98 0.36
99 0.3
100 0.24
101 0.25
102 0.24
103 0.23
104 0.18
105 0.15
106 0.13
107 0.15
108 0.16
109 0.14
110 0.11
111 0.14
112 0.15
113 0.21
114 0.26
115 0.28
116 0.3
117 0.33
118 0.33
119 0.33
120 0.33
121 0.29
122 0.24
123 0.2
124 0.17
125 0.14
126 0.14
127 0.12
128 0.1
129 0.09
130 0.09
131 0.08
132 0.08
133 0.08
134 0.07
135 0.06
136 0.06
137 0.06
138 0.06
139 0.06
140 0.06
141 0.09
142 0.11
143 0.14
144 0.16
145 0.2
146 0.3
147 0.35
148 0.37
149 0.41
150 0.42
151 0.42
152 0.43
153 0.4
154 0.34
155 0.32
156 0.32
157 0.26
158 0.28
159 0.26
160 0.24
161 0.25
162 0.21
163 0.19
164 0.25
165 0.31
166 0.32
167 0.36
168 0.42
169 0.48
170 0.54
171 0.56
172 0.54
173 0.48
174 0.44
175 0.4
176 0.34
177 0.33
178 0.33
179 0.35
180 0.31
181 0.31
182 0.28
183 0.31
184 0.3
185 0.25
186 0.19
187 0.19
188 0.19
189 0.25
190 0.29
191 0.27
192 0.27
193 0.3
194 0.28
195 0.26
196 0.26
197 0.23
198 0.23
199 0.23
200 0.22
201 0.21
202 0.21
203 0.18
204 0.18
205 0.15
206 0.18
207 0.24
208 0.26
209 0.24
210 0.31
211 0.33
212 0.37
213 0.36
214 0.31
215 0.26
216 0.26
217 0.27
218 0.2
219 0.18
220 0.18
221 0.19
222 0.18
223 0.19
224 0.19
225 0.17
226 0.23
227 0.28
228 0.34
229 0.37
230 0.44
231 0.45
232 0.5
233 0.54
234 0.54
235 0.58
236 0.59
237 0.66
238 0.67
239 0.74
240 0.75
241 0.82
242 0.85
243 0.85
244 0.85
245 0.83
246 0.82
247 0.81
248 0.84
249 0.8
250 0.79
251 0.79
252 0.74
253 0.76
254 0.71
255 0.71
256 0.72
257 0.76
258 0.77
259 0.78