FuNGI

Q752W2

Protein Details

Accession

Q752W2

Localization Confidence

Medium

Confidence Score

14.9

NoLS Segment(s)

Position	Sequence	Protein Nature
340-363	NFKGEPRSKRAMRRGRRKRFSIGP	Basic

NLS Segment(s)

Position	Sequence
344-358	EPRSKRAMRRGRRKR

Subcellular Location(s)

nucl 18, mito 6, cyto 2

Family & Domain DBs

InterPro	View protein in InterPro IPR036236 Znf_C2H2_sf IPR013087 Znf_C2H2_type
Gene Ontology	GO:0005737 C:cytoplasm GO:0005634 C:nucleus GO:0005886 C:plasma membrane GO:0001228 F:DNA-binding transcription activator activity, RNA polymerase II-specific GO:0000981 F:DNA-binding transcription factor activity, RNA polymerase II-specific GO:0000978 F:RNA polymerase II cis-regulatory region sequence-specific DNA binding GO:0006357 P:regulation of transcription by RNA polymerase II
KEGG	ago:AGOS_AFR461C -
PROSITE	View protein in PROSITE PS00028 ZINC_FINGER_C2H2_1 PS50157 ZINC_FINGER_C2H2_2

Amino Acid Sequences

MISEQAPGWRGTVVGRMSAKVLSWLWSWAQQVSVGVGKNDDERADAAVAKAADTGPRRRRGTVSGLFPKRHNVDARLDLQASVVACSIDLSTLQSPISMTRTPEGGMEWKLNAGAHAGTPTQSNEEPLSPRSSSSAAQLKDEDGDELSKERFVCHYCDAEFRIRGYLTRHIKKHAVEKAYHCPFFNSHVPPETRCHTTGGFSRRDTYKTHLRSRHFIYPEGVKTQDRGKSCGHCAHCGKWFENTSTWIEKHIESGYCTGLPEGTILPAKSARKAGKLKMIKTSTGHSRFITTQQSVVEPKVLLNKEAIEAMQIVVNETNTAGQPALTKLSDNRIMLNSMNFKGEPRSKRAMRRGRRKRFSIGPAMAAHACANSASMMPSNAGATSATSCPIDAQLQPQMYMPHTGAAYTFTTPDETPLDEICLSLNPSPTDDASLVPVRSASSLSSHECQQPANNDMNKLLYPLISSNPVGIQDPYSIPLDFEQMGFAMAAEETPVLPAQKLVSEPQINVTLNRQMDPIKLGERQFRETQQYLNFYNYSFDTNL

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.23
2	0.24
3	0.24
4	0.25
5	0.25
6	0.24
7	0.22
8	0.21
9	0.18
10	0.18
11	0.2
12	0.2
13	0.23
14	0.25
15	0.21
16	0.21
17	0.19
18	0.19
19	0.19
20	0.21
21	0.18
22	0.17
23	0.17
24	0.17
25	0.19
26	0.2
27	0.18
28	0.15
29	0.15
30	0.17
31	0.17
32	0.17
33	0.14
34	0.16
35	0.16
36	0.14
37	0.14
38	0.12
39	0.16
40	0.21
41	0.31
42	0.36
43	0.45
44	0.48
45	0.51
46	0.55
47	0.55
48	0.6
49	0.57
50	0.59
51	0.6
52	0.64
53	0.63
54	0.61
55	0.63
56	0.57
57	0.56
58	0.51
59	0.45
60	0.45
61	0.48
62	0.5
63	0.46
64	0.44
65	0.37
66	0.32
67	0.29
68	0.22
69	0.16
70	0.13
71	0.08
72	0.08
73	0.08
74	0.08
75	0.06
76	0.06
77	0.09
78	0.09
79	0.11
80	0.11
81	0.1
82	0.11
83	0.12
84	0.17
85	0.15
86	0.16
87	0.17
88	0.18
89	0.18
90	0.18
91	0.19
92	0.18
93	0.19
94	0.19
95	0.18
96	0.17
97	0.17
98	0.17
99	0.14
100	0.12
101	0.1
102	0.08
103	0.09
104	0.09
105	0.09
106	0.11
107	0.11
108	0.14
109	0.14
110	0.16
111	0.16
112	0.18
113	0.21
114	0.22
115	0.25
116	0.22
117	0.22
118	0.22
119	0.22
120	0.2
121	0.24
122	0.29
123	0.25
124	0.27
125	0.27
126	0.25
127	0.25
128	0.24
129	0.18
130	0.12
131	0.12
132	0.11
133	0.12
134	0.11
135	0.12
136	0.12
137	0.12
138	0.14
139	0.16
140	0.19
141	0.2
142	0.23
143	0.22
144	0.26
145	0.28
146	0.31
147	0.3
148	0.27
149	0.27
150	0.24
151	0.24
152	0.25
153	0.31
154	0.35
155	0.41
156	0.42
157	0.44
158	0.49
159	0.5
160	0.55
161	0.53
162	0.48
163	0.45
164	0.48
165	0.54
166	0.56
167	0.54
168	0.45
169	0.4
170	0.36
171	0.37
172	0.38
173	0.32
174	0.27
175	0.32
176	0.33
177	0.34
178	0.36
179	0.35
180	0.32
181	0.29
182	0.29
183	0.24
184	0.26
185	0.3
186	0.32
187	0.33
188	0.3
189	0.33
190	0.33
191	0.35
192	0.34
193	0.34
194	0.37
195	0.4
196	0.48
197	0.51
198	0.53
199	0.57
200	0.6
201	0.62
202	0.55
203	0.49
204	0.43
205	0.41
206	0.4
207	0.36
208	0.32
209	0.24
210	0.23
211	0.27
212	0.29
213	0.24
214	0.26
215	0.26
216	0.28
217	0.32
218	0.38
219	0.35
220	0.37
221	0.38
222	0.38
223	0.4
224	0.39
225	0.36
226	0.35
227	0.34
228	0.29
229	0.28
230	0.28
231	0.25
232	0.26
233	0.25
234	0.22
235	0.22
236	0.2
237	0.2
238	0.19
239	0.16
240	0.14
241	0.15
242	0.14
243	0.12
244	0.12
245	0.1
246	0.08
247	0.07
248	0.07
249	0.05
250	0.06
251	0.07
252	0.06
253	0.07
254	0.11
255	0.11
256	0.12
257	0.18
258	0.18
259	0.25
260	0.29
261	0.31
262	0.37
263	0.42
264	0.42
265	0.46
266	0.46
267	0.4
268	0.38
269	0.38
270	0.38
271	0.37
272	0.37
273	0.29
274	0.29
275	0.28
276	0.31
277	0.32
278	0.23
279	0.2
280	0.19
281	0.21
282	0.19
283	0.18
284	0.16
285	0.12
286	0.12
287	0.17
288	0.17
289	0.15
290	0.15
291	0.15
292	0.14
293	0.14
294	0.13
295	0.07
296	0.07
297	0.06
298	0.07
299	0.06
300	0.06
301	0.06
302	0.06
303	0.06
304	0.06
305	0.06
306	0.05
307	0.06
308	0.05
309	0.05
310	0.06
311	0.07
312	0.09
313	0.08
314	0.09
315	0.1
316	0.15
317	0.19
318	0.18
319	0.19
320	0.18
321	0.2
322	0.2
323	0.22
324	0.21
325	0.17
326	0.18
327	0.16
328	0.16
329	0.21
330	0.28
331	0.28
332	0.31
333	0.39
334	0.44
335	0.53
336	0.63
337	0.67
338	0.7
339	0.78
340	0.82
341	0.85
342	0.88
343	0.84
344	0.81
345	0.79
346	0.75
347	0.74
348	0.64
349	0.57
350	0.49
351	0.46
352	0.39
353	0.31
354	0.24
355	0.14
356	0.12
357	0.08
358	0.07
359	0.05
360	0.05
361	0.06
362	0.06
363	0.07
364	0.07
365	0.07
366	0.07
367	0.07
368	0.07
369	0.06
370	0.06
371	0.08
372	0.09
373	0.09
374	0.09
375	0.09
376	0.09
377	0.11
378	0.12
379	0.1
380	0.13
381	0.17
382	0.18
383	0.18
384	0.19
385	0.2
386	0.19
387	0.2
388	0.17
389	0.14
390	0.13
391	0.13
392	0.12
393	0.13
394	0.13
395	0.12
396	0.12
397	0.1
398	0.13
399	0.13
400	0.15
401	0.14
402	0.14
403	0.15
404	0.14
405	0.16
406	0.13
407	0.13
408	0.12
409	0.12
410	0.13
411	0.13
412	0.16
413	0.14
414	0.15
415	0.17
416	0.17
417	0.18
418	0.17
419	0.15
420	0.16
421	0.2
422	0.18
423	0.17
424	0.17
425	0.14
426	0.15
427	0.15
428	0.11
429	0.11
430	0.14
431	0.18
432	0.2
433	0.23
434	0.27
435	0.27
436	0.27
437	0.29
438	0.3
439	0.3
440	0.36
441	0.36
442	0.33
443	0.33
444	0.35
445	0.3
446	0.27
447	0.23
448	0.15
449	0.14
450	0.14
451	0.16
452	0.16
453	0.16
454	0.16
455	0.16
456	0.17
457	0.17
458	0.16
459	0.16
460	0.15
461	0.16
462	0.17
463	0.18
464	0.16
465	0.16
466	0.15
467	0.17
468	0.15
469	0.14
470	0.12
471	0.1
472	0.11
473	0.1
474	0.09
475	0.06
476	0.06
477	0.06
478	0.05
479	0.06
480	0.05
481	0.06
482	0.08
483	0.08
484	0.08
485	0.09
486	0.1
487	0.12
488	0.14
489	0.16
490	0.23
491	0.25
492	0.26
493	0.29
494	0.34
495	0.33
496	0.33
497	0.34
498	0.32
499	0.31
500	0.31
501	0.29
502	0.24
503	0.26
504	0.27
505	0.27
506	0.25
507	0.29
508	0.32
509	0.39
510	0.42
511	0.46
512	0.49
513	0.51
514	0.55
515	0.51
516	0.53
517	0.51
518	0.53
519	0.48
520	0.48
521	0.43
522	0.35
523	0.36
524	0.31

Q752W2

3D AlphaFold-predicted Structure Viewer