Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q752W2

Protein Details
Accession Q752W2   
Localization Confidence Medium
Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
340-363NFKGEPRSKRAMRRGRRKRFSIGPBasic
NLS Segment(s)
PositionSequence
344-358EPRSKRAMRRGRRKR
Subcellular Location(s) nucl 18, mito 6, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
GO:0005886  C:plasma membrane  
GO:0001228  F:DNA-binding transcription activator activity, RNA polymerase II-specific  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0000978  F:RNA polymerase II cis-regulatory region sequence-specific DNA binding  
GO:0006357  P:regulation of transcription by RNA polymerase II  
KEGG ago:AGOS_AFR461C  -  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MISEQAPGWRGTVVGRMSAKVLSWLWSWAQQVSVGVGKNDDERADAAVAKAADTGPRRRRGTVSGLFPKRHNVDARLDLQASVVACSIDLSTLQSPISMTRTPEGGMEWKLNAGAHAGTPTQSNEEPLSPRSSSSAAQLKDEDGDELSKERFVCHYCDAEFRIRGYLTRHIKKHAVEKAYHCPFFNSHVPPETRCHTTGGFSRRDTYKTHLRSRHFIYPEGVKTQDRGKSCGHCAHCGKWFENTSTWIEKHIESGYCTGLPEGTILPAKSARKAGKLKMIKTSTGHSRFITTQQSVVEPKVLLNKEAIEAMQIVVNETNTAGQPALTKLSDNRIMLNSMNFKGEPRSKRAMRRGRRKRFSIGPAMAAHACANSASMMPSNAGATSATSCPIDAQLQPQMYMPHTGAAYTFTTPDETPLDEICLSLNPSPTDDASLVPVRSASSLSSHECQQPANNDMNKLLYPLISSNPVGIQDPYSIPLDFEQMGFAMAAEETPVLPAQKLVSEPQINVTLNRQMDPIKLGERQFRETQQYLNFYNYSFDTNL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.24
3 0.24
4 0.25
5 0.25
6 0.24
7 0.22
8 0.21
9 0.18
10 0.18
11 0.2
12 0.2
13 0.23
14 0.25
15 0.21
16 0.21
17 0.19
18 0.19
19 0.19
20 0.21
21 0.18
22 0.17
23 0.17
24 0.17
25 0.19
26 0.2
27 0.18
28 0.15
29 0.15
30 0.17
31 0.17
32 0.17
33 0.14
34 0.16
35 0.16
36 0.14
37 0.14
38 0.12
39 0.16
40 0.21
41 0.31
42 0.36
43 0.45
44 0.48
45 0.51
46 0.55
47 0.55
48 0.6
49 0.57
50 0.59
51 0.6
52 0.64
53 0.63
54 0.61
55 0.63
56 0.57
57 0.56
58 0.51
59 0.45
60 0.45
61 0.48
62 0.5
63 0.46
64 0.44
65 0.37
66 0.32
67 0.29
68 0.22
69 0.16
70 0.13
71 0.08
72 0.08
73 0.08
74 0.08
75 0.06
76 0.06
77 0.09
78 0.09
79 0.11
80 0.11
81 0.1
82 0.11
83 0.12
84 0.17
85 0.15
86 0.16
87 0.17
88 0.18
89 0.18
90 0.18
91 0.19
92 0.18
93 0.19
94 0.19
95 0.18
96 0.17
97 0.17
98 0.17
99 0.14
100 0.12
101 0.1
102 0.08
103 0.09
104 0.09
105 0.09
106 0.11
107 0.11
108 0.14
109 0.14
110 0.16
111 0.16
112 0.18
113 0.21
114 0.22
115 0.25
116 0.22
117 0.22
118 0.22
119 0.22
120 0.2
121 0.24
122 0.29
123 0.25
124 0.27
125 0.27
126 0.25
127 0.25
128 0.24
129 0.18
130 0.12
131 0.12
132 0.11
133 0.12
134 0.11
135 0.12
136 0.12
137 0.12
138 0.14
139 0.16
140 0.19
141 0.2
142 0.23
143 0.22
144 0.26
145 0.28
146 0.31
147 0.3
148 0.27
149 0.27
150 0.24
151 0.24
152 0.25
153 0.31
154 0.35
155 0.41
156 0.42
157 0.44
158 0.49
159 0.5
160 0.55
161 0.53
162 0.48
163 0.45
164 0.48
165 0.54
166 0.56
167 0.54
168 0.45
169 0.4
170 0.36
171 0.37
172 0.38
173 0.32
174 0.27
175 0.32
176 0.33
177 0.34
178 0.36
179 0.35
180 0.32
181 0.29
182 0.29
183 0.24
184 0.26
185 0.3
186 0.32
187 0.33
188 0.3
189 0.33
190 0.33
191 0.35
192 0.34
193 0.34
194 0.37
195 0.4
196 0.48
197 0.51
198 0.53
199 0.57
200 0.6
201 0.62
202 0.55
203 0.49
204 0.43
205 0.41
206 0.4
207 0.36
208 0.32
209 0.24
210 0.23
211 0.27
212 0.29
213 0.24
214 0.26
215 0.26
216 0.28
217 0.32
218 0.38
219 0.35
220 0.37
221 0.38
222 0.38
223 0.4
224 0.39
225 0.36
226 0.35
227 0.34
228 0.29
229 0.28
230 0.28
231 0.25
232 0.26
233 0.25
234 0.22
235 0.22
236 0.2
237 0.2
238 0.19
239 0.16
240 0.14
241 0.15
242 0.14
243 0.12
244 0.12
245 0.1
246 0.08
247 0.07
248 0.07
249 0.05
250 0.06
251 0.07
252 0.06
253 0.07
254 0.11
255 0.11
256 0.12
257 0.18
258 0.18
259 0.25
260 0.29
261 0.31
262 0.37
263 0.42
264 0.42
265 0.46
266 0.46
267 0.4
268 0.38
269 0.38
270 0.38
271 0.37
272 0.37
273 0.29
274 0.29
275 0.28
276 0.31
277 0.32
278 0.23
279 0.2
280 0.19
281 0.21
282 0.19
283 0.18
284 0.16
285 0.12
286 0.12
287 0.17
288 0.17
289 0.15
290 0.15
291 0.15
292 0.14
293 0.14
294 0.13
295 0.07
296 0.07
297 0.06
298 0.07
299 0.06
300 0.06
301 0.06
302 0.06
303 0.06
304 0.06
305 0.06
306 0.05
307 0.06
308 0.05
309 0.05
310 0.06
311 0.07
312 0.09
313 0.08
314 0.09
315 0.1
316 0.15
317 0.19
318 0.18
319 0.19
320 0.18
321 0.2
322 0.2
323 0.22
324 0.21
325 0.17
326 0.18
327 0.16
328 0.16
329 0.21
330 0.28
331 0.28
332 0.31
333 0.39
334 0.44
335 0.53
336 0.63
337 0.67
338 0.7
339 0.78
340 0.82
341 0.85
342 0.88
343 0.84
344 0.81
345 0.79
346 0.75
347 0.74
348 0.64
349 0.57
350 0.49
351 0.46
352 0.39
353 0.31
354 0.24
355 0.14
356 0.12
357 0.08
358 0.07
359 0.05
360 0.05
361 0.06
362 0.06
363 0.07
364 0.07
365 0.07
366 0.07
367 0.07
368 0.07
369 0.06
370 0.06
371 0.08
372 0.09
373 0.09
374 0.09
375 0.09
376 0.09
377 0.11
378 0.12
379 0.1
380 0.13
381 0.17
382 0.18
383 0.18
384 0.19
385 0.2
386 0.19
387 0.2
388 0.17
389 0.14
390 0.13
391 0.13
392 0.12
393 0.13
394 0.13
395 0.12
396 0.12
397 0.1
398 0.13
399 0.13
400 0.15
401 0.14
402 0.14
403 0.15
404 0.14
405 0.16
406 0.13
407 0.13
408 0.12
409 0.12
410 0.13
411 0.13
412 0.16
413 0.14
414 0.15
415 0.17
416 0.17
417 0.18
418 0.17
419 0.15
420 0.16
421 0.2
422 0.18
423 0.17
424 0.17
425 0.14
426 0.15
427 0.15
428 0.11
429 0.11
430 0.14
431 0.18
432 0.2
433 0.23
434 0.27
435 0.27
436 0.27
437 0.29
438 0.3
439 0.3
440 0.36
441 0.36
442 0.33
443 0.33
444 0.35
445 0.3
446 0.27
447 0.23
448 0.15
449 0.14
450 0.14
451 0.16
452 0.16
453 0.16
454 0.16
455 0.16
456 0.17
457 0.17
458 0.16
459 0.16
460 0.15
461 0.16
462 0.17
463 0.18
464 0.16
465 0.16
466 0.15
467 0.17
468 0.15
469 0.14
470 0.12
471 0.1
472 0.11
473 0.1
474 0.09
475 0.06
476 0.06
477 0.06
478 0.05
479 0.06
480 0.05
481 0.06
482 0.08
483 0.08
484 0.08
485 0.09
486 0.1
487 0.12
488 0.14
489 0.16
490 0.23
491 0.25
492 0.26
493 0.29
494 0.34
495 0.33
496 0.33
497 0.34
498 0.32
499 0.31
500 0.31
501 0.29
502 0.24
503 0.26
504 0.27
505 0.27
506 0.25
507 0.29
508 0.32
509 0.39
510 0.42
511 0.46
512 0.49
513 0.51
514 0.55
515 0.51
516 0.53
517 0.51
518 0.53
519 0.48
520 0.48
521 0.43
522 0.35
523 0.36
524 0.31