Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179V1I3

Protein Details
Accession A0A179V1I3    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
100-126IQSQKSFRTKQKLAKAQKQNRPIPQWIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, nucl 5, plas 4, extr 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR000077  Ribosomal_L39  
IPR023626  Ribosomal_L39e_dom_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00832  Ribosomal_L39  
Amino Acid Sequences MPKPTLNNLIRMSPSRAPTISRDSARHAKPDHAHQVSSIYSALDRQDAGMCEILTATDFLPVPSPYVDRPLAGAAPLPPPLLLLLLLVRIEITANLGSEIQSQKSFRTKQKLAKAQKQNRPIPQWIRLRTGNTIR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.38
3 0.37
4 0.35
5 0.36
6 0.41
7 0.42
8 0.4
9 0.4
10 0.43
11 0.51
12 0.51
13 0.53
14 0.47
15 0.47
16 0.47
17 0.53
18 0.56
19 0.49
20 0.47
21 0.4
22 0.41
23 0.34
24 0.31
25 0.22
26 0.12
27 0.1
28 0.11
29 0.11
30 0.09
31 0.08
32 0.08
33 0.09
34 0.1
35 0.11
36 0.11
37 0.1
38 0.1
39 0.09
40 0.08
41 0.07
42 0.07
43 0.05
44 0.06
45 0.06
46 0.06
47 0.08
48 0.08
49 0.09
50 0.09
51 0.1
52 0.08
53 0.12
54 0.13
55 0.11
56 0.11
57 0.11
58 0.11
59 0.1
60 0.1
61 0.07
62 0.08
63 0.09
64 0.08
65 0.07
66 0.07
67 0.07
68 0.07
69 0.06
70 0.05
71 0.04
72 0.05
73 0.05
74 0.05
75 0.05
76 0.04
77 0.04
78 0.04
79 0.06
80 0.05
81 0.05
82 0.06
83 0.07
84 0.07
85 0.11
86 0.12
87 0.12
88 0.15
89 0.15
90 0.19
91 0.27
92 0.33
93 0.37
94 0.46
95 0.51
96 0.58
97 0.68
98 0.74
99 0.76
100 0.8
101 0.84
102 0.84
103 0.86
104 0.87
105 0.85
106 0.84
107 0.81
108 0.8
109 0.76
110 0.75
111 0.75
112 0.7
113 0.68
114 0.64
115 0.62