Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N5WTR3

Protein Details
Accession A0A5N5WTR3    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
84-127KRATYNPSRRVQKRRHGFLARLRSRGGRKILLRRKARGRKTLSWHydrophilic
NLS Segment(s)
PositionSequence
91-123SRRVQKRRHGFLARLRSRGGRKILLRRKARGRK
Subcellular Location(s) mito 14, nucl 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MLCFRCRAVPSALRTYASPMSMSRYLKPTLTITTTPFSTISSPLRPMTNFNSIRPQPQQTLSTKLPFAAQQTRSFSASASLAGKRATYNPSRRVQKRRHGFLARLRSRGGRKILLRRKARGRKTLSW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.43
3 0.38
4 0.32
5 0.27
6 0.19
7 0.23
8 0.28
9 0.3
10 0.28
11 0.29
12 0.3
13 0.29
14 0.31
15 0.27
16 0.25
17 0.27
18 0.26
19 0.25
20 0.26
21 0.25
22 0.24
23 0.21
24 0.19
25 0.15
26 0.17
27 0.18
28 0.18
29 0.2
30 0.2
31 0.22
32 0.21
33 0.23
34 0.25
35 0.31
36 0.3
37 0.29
38 0.36
39 0.35
40 0.39
41 0.39
42 0.37
43 0.3
44 0.31
45 0.34
46 0.27
47 0.33
48 0.31
49 0.29
50 0.26
51 0.24
52 0.22
53 0.19
54 0.2
55 0.21
56 0.21
57 0.24
58 0.28
59 0.29
60 0.3
61 0.29
62 0.25
63 0.19
64 0.17
65 0.15
66 0.13
67 0.11
68 0.11
69 0.12
70 0.12
71 0.11
72 0.14
73 0.17
74 0.23
75 0.3
76 0.37
77 0.45
78 0.55
79 0.62
80 0.7
81 0.74
82 0.77
83 0.79
84 0.8
85 0.81
86 0.78
87 0.76
88 0.76
89 0.78
90 0.73
91 0.66
92 0.59
93 0.57
94 0.56
95 0.56
96 0.53
97 0.5
98 0.52
99 0.6
100 0.68
101 0.7
102 0.73
103 0.75
104 0.8
105 0.82
106 0.84
107 0.82