Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N5WRL7

Protein Details
Accession A0A5N5WRL7    Localization Confidence Medium Confidence Score 14.6
NoLS Segment(s)
PositionSequenceProtein Nature
138-158CDWIERFTRKCKNPRWREVVQHydrophilic
188-211EAKRHGVRSKTSKPGRKPSKASKTBasic
NLS Segment(s)
PositionSequence
190-211KRHGVRSKTSKPGRKPSKASKT
Subcellular Location(s) nucl 16, cyto_nucl 11, mito 4, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036388  WH-like_DNA-bd_sf  
IPR036390  WH_DNA-bd_sf  
Amino Acid Sequences MSLRRSSLEGFPIVSTQGDDVGVFVQQHLYNLFMSSRRGSMKGISIFSTQDVDVGAFVDAATTRDDKNCDLKGNLNSDHPSSEIRDNDLQGRPSTAPDKRLEHSNPETGSLIDGTYAALLVQCFQCAPQGQRSFIDACDWIERFTRKCKNPRWREVVQNTLKRNPAFELVGKVSSTKCKAQVWRLTGEAKRHGVRSKTSKPGRKPSKASKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.15
3 0.11
4 0.11
5 0.09
6 0.08
7 0.08
8 0.08
9 0.09
10 0.08
11 0.08
12 0.11
13 0.11
14 0.12
15 0.12
16 0.13
17 0.12
18 0.13
19 0.14
20 0.12
21 0.15
22 0.16
23 0.19
24 0.2
25 0.21
26 0.22
27 0.23
28 0.29
29 0.3
30 0.29
31 0.28
32 0.27
33 0.26
34 0.26
35 0.25
36 0.17
37 0.13
38 0.12
39 0.09
40 0.08
41 0.08
42 0.07
43 0.05
44 0.05
45 0.05
46 0.05
47 0.05
48 0.07
49 0.08
50 0.09
51 0.11
52 0.13
53 0.15
54 0.21
55 0.23
56 0.24
57 0.24
58 0.29
59 0.31
60 0.34
61 0.33
62 0.3
63 0.29
64 0.27
65 0.26
66 0.21
67 0.18
68 0.16
69 0.19
70 0.17
71 0.19
72 0.2
73 0.2
74 0.24
75 0.25
76 0.24
77 0.2
78 0.22
79 0.18
80 0.18
81 0.23
82 0.2
83 0.22
84 0.24
85 0.27
86 0.26
87 0.32
88 0.32
89 0.33
90 0.35
91 0.35
92 0.31
93 0.29
94 0.28
95 0.22
96 0.21
97 0.14
98 0.11
99 0.06
100 0.06
101 0.04
102 0.04
103 0.03
104 0.03
105 0.03
106 0.03
107 0.04
108 0.04
109 0.04
110 0.04
111 0.05
112 0.07
113 0.09
114 0.11
115 0.19
116 0.21
117 0.23
118 0.24
119 0.26
120 0.25
121 0.23
122 0.23
123 0.15
124 0.14
125 0.16
126 0.16
127 0.15
128 0.17
129 0.2
130 0.2
131 0.29
132 0.37
133 0.41
134 0.5
135 0.6
136 0.67
137 0.75
138 0.82
139 0.81
140 0.77
141 0.8
142 0.77
143 0.77
144 0.75
145 0.72
146 0.67
147 0.65
148 0.65
149 0.55
150 0.5
151 0.42
152 0.36
153 0.31
154 0.28
155 0.29
156 0.26
157 0.27
158 0.25
159 0.24
160 0.22
161 0.26
162 0.28
163 0.27
164 0.29
165 0.34
166 0.41
167 0.49
168 0.56
169 0.53
170 0.54
171 0.53
172 0.55
173 0.53
174 0.53
175 0.51
176 0.49
177 0.48
178 0.49
179 0.52
180 0.5
181 0.55
182 0.58
183 0.6
184 0.64
185 0.71
186 0.76
187 0.78
188 0.85
189 0.87
190 0.87
191 0.87