Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N5WXK4

Protein Details
Accession A0A5N5WXK4    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
61-90GRQGWEINRRRSRERKKKERKKKKKNRKKRBasic
NLS Segment(s)
PositionSequence
58-90KKIGRQGWEINRRRSRERKKKERKKKKKNRKKR
Subcellular Location(s) mito 13, nucl 6, plas 6
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MVHRTHPLCQSIMHVIIVHSFTISYIVLGMLSQSHNRLYRPISSHSMQAQTRHWHNGKKIGRQGWEINRRRSRERKKKERKKKKKNRKKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.18
3 0.19
4 0.19
5 0.15
6 0.1
7 0.08
8 0.08
9 0.09
10 0.08
11 0.06
12 0.05
13 0.05
14 0.05
15 0.05
16 0.05
17 0.05
18 0.06
19 0.07
20 0.08
21 0.11
22 0.12
23 0.13
24 0.16
25 0.16
26 0.2
27 0.23
28 0.26
29 0.28
30 0.27
31 0.3
32 0.29
33 0.32
34 0.28
35 0.27
36 0.27
37 0.27
38 0.29
39 0.34
40 0.35
41 0.35
42 0.36
43 0.44
44 0.46
45 0.5
46 0.54
47 0.52
48 0.52
49 0.51
50 0.56
51 0.56
52 0.61
53 0.6
54 0.64
55 0.66
56 0.68
57 0.73
58 0.76
59 0.78
60 0.78
61 0.82
62 0.84
63 0.88
64 0.94
65 0.96
66 0.97
67 0.97
68 0.97
69 0.98
70 0.98