Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N5WT69

Protein Details
Accession A0A5N5WT69    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
18-39SRQSRVRAFRHHRAERRRPGTPBasic
NLS Segment(s)
PositionSequence
16-46KGSRQSRVRAFRHHRAERRRPGTPAHPPRPK
Subcellular Location(s) mito 15, nucl 9, cyto 2
Family & Domain DBs
Amino Acid Sequences MVLEPSNRQQWQLQRKGSRQSRVRAFRHHRAERRRPGTPAHPPRPKSAFAALCQSLRSGYFSAWFMCLFCDNCADVLRSRPHRPEESLLSYGLPLLVLY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.67
3 0.75
4 0.77
5 0.77
6 0.74
7 0.74
8 0.75
9 0.76
10 0.75
11 0.75
12 0.75
13 0.75
14 0.79
15 0.79
16 0.78
17 0.79
18 0.85
19 0.84
20 0.82
21 0.76
22 0.68
23 0.64
24 0.63
25 0.63
26 0.63
27 0.62
28 0.63
29 0.61
30 0.65
31 0.63
32 0.57
33 0.49
34 0.45
35 0.38
36 0.31
37 0.35
38 0.3
39 0.27
40 0.25
41 0.22
42 0.16
43 0.13
44 0.14
45 0.09
46 0.08
47 0.1
48 0.11
49 0.11
50 0.12
51 0.11
52 0.09
53 0.1
54 0.12
55 0.11
56 0.11
57 0.12
58 0.12
59 0.13
60 0.14
61 0.15
62 0.14
63 0.19
64 0.27
65 0.31
66 0.37
67 0.42
68 0.48
69 0.51
70 0.55
71 0.55
72 0.55
73 0.55
74 0.51
75 0.45
76 0.39
77 0.34
78 0.29
79 0.22