Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N5XAZ5

Protein Details
Accession A0A5N5XAZ5    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
260-309PTEPRRVREPSARRHNRRRERRHNPPPTSSSRQSSPRKRERRSMPGHYTEBasic
NLS Segment(s)
PositionSequence
155-173KGGPRRKRGFREKLLGRRR
264-301RRVREPSARRHNRRRERRHNPPPTSSSRQSSPRKRERR
Subcellular Location(s) nucl 15, cyto_nucl 10, plas 5, cyto 3, golg 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPPIRQAGVDFPDIPATSVPSNNDVLSQIKPSPEVKHLMARADSTKYVPGTGAVDPHKINMQGLMALFAIIGAAFVFAAIWFFFWAKNGGFIWRKGDWEDYKSTVLRRKGPDGETLSNATKSTKLGGGSIVGKGYTDDGYTVSGYTDTATEVTEKGGPRRKRGFREKLLGRRREEQYENEADEDVRAYRKERPARIGGINCEGDGTYHGSDYDTSQPPSYYQQSEMSQVRDYAYEPTRHKSKRRDFSFTPGTEETLSQPPTEPRRVREPSARRHNRRRERRHNPPPTSSSRQSSPRKRERRSMPGHYTEPLDFSSSAPSRSEYQYSNVDTEDSGTKTYHHPIPGLTKGYRREGGRGRRRDSLSDSDGDATR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.2
3 0.2
4 0.18
5 0.21
6 0.22
7 0.21
8 0.23
9 0.22
10 0.22
11 0.21
12 0.21
13 0.2
14 0.22
15 0.21
16 0.21
17 0.24
18 0.26
19 0.28
20 0.31
21 0.34
22 0.33
23 0.38
24 0.4
25 0.41
26 0.39
27 0.38
28 0.37
29 0.36
30 0.34
31 0.28
32 0.3
33 0.26
34 0.25
35 0.22
36 0.2
37 0.19
38 0.18
39 0.22
40 0.2
41 0.23
42 0.23
43 0.24
44 0.26
45 0.23
46 0.23
47 0.18
48 0.17
49 0.15
50 0.15
51 0.14
52 0.11
53 0.1
54 0.1
55 0.07
56 0.07
57 0.04
58 0.04
59 0.03
60 0.03
61 0.02
62 0.02
63 0.03
64 0.03
65 0.04
66 0.04
67 0.04
68 0.05
69 0.06
70 0.06
71 0.07
72 0.1
73 0.1
74 0.13
75 0.13
76 0.19
77 0.22
78 0.23
79 0.27
80 0.26
81 0.27
82 0.26
83 0.33
84 0.3
85 0.31
86 0.33
87 0.31
88 0.33
89 0.33
90 0.36
91 0.36
92 0.38
93 0.41
94 0.41
95 0.45
96 0.48
97 0.48
98 0.51
99 0.5
100 0.48
101 0.43
102 0.42
103 0.37
104 0.32
105 0.3
106 0.23
107 0.18
108 0.16
109 0.15
110 0.14
111 0.13
112 0.12
113 0.13
114 0.14
115 0.14
116 0.14
117 0.12
118 0.1
119 0.09
120 0.09
121 0.1
122 0.07
123 0.06
124 0.06
125 0.06
126 0.07
127 0.08
128 0.07
129 0.06
130 0.06
131 0.06
132 0.06
133 0.06
134 0.05
135 0.05
136 0.05
137 0.06
138 0.06
139 0.07
140 0.1
141 0.11
142 0.16
143 0.25
144 0.27
145 0.34
146 0.44
147 0.5
148 0.56
149 0.67
150 0.71
151 0.69
152 0.76
153 0.77
154 0.77
155 0.8
156 0.77
157 0.7
158 0.67
159 0.63
160 0.59
161 0.53
162 0.46
163 0.43
164 0.39
165 0.36
166 0.29
167 0.27
168 0.21
169 0.18
170 0.15
171 0.1
172 0.07
173 0.07
174 0.08
175 0.14
176 0.22
177 0.28
178 0.31
179 0.35
180 0.38
181 0.41
182 0.45
183 0.42
184 0.36
185 0.34
186 0.31
187 0.26
188 0.22
189 0.18
190 0.13
191 0.11
192 0.12
193 0.08
194 0.08
195 0.08
196 0.08
197 0.09
198 0.1
199 0.16
200 0.15
201 0.16
202 0.17
203 0.17
204 0.18
205 0.22
206 0.23
207 0.18
208 0.18
209 0.21
210 0.22
211 0.27
212 0.28
213 0.26
214 0.23
215 0.22
216 0.21
217 0.17
218 0.17
219 0.17
220 0.19
221 0.23
222 0.24
223 0.29
224 0.37
225 0.42
226 0.49
227 0.54
228 0.61
229 0.65
230 0.69
231 0.73
232 0.67
233 0.71
234 0.72
235 0.62
236 0.58
237 0.48
238 0.43
239 0.35
240 0.33
241 0.28
242 0.24
243 0.24
244 0.18
245 0.19
246 0.23
247 0.28
248 0.37
249 0.37
250 0.35
251 0.44
252 0.49
253 0.52
254 0.57
255 0.6
256 0.62
257 0.7
258 0.77
259 0.77
260 0.83
261 0.89
262 0.9
263 0.92
264 0.93
265 0.93
266 0.92
267 0.94
268 0.94
269 0.94
270 0.9
271 0.87
272 0.83
273 0.81
274 0.79
275 0.72
276 0.66
277 0.61
278 0.64
279 0.66
280 0.69
281 0.72
282 0.74
283 0.79
284 0.81
285 0.85
286 0.85
287 0.85
288 0.84
289 0.83
290 0.81
291 0.78
292 0.75
293 0.67
294 0.6
295 0.5
296 0.43
297 0.33
298 0.27
299 0.2
300 0.18
301 0.24
302 0.22
303 0.23
304 0.22
305 0.24
306 0.24
307 0.28
308 0.31
309 0.25
310 0.28
311 0.33
312 0.35
313 0.34
314 0.31
315 0.28
316 0.24
317 0.25
318 0.24
319 0.18
320 0.17
321 0.16
322 0.17
323 0.2
324 0.26
325 0.29
326 0.27
327 0.27
328 0.29
329 0.37
330 0.42
331 0.44
332 0.41
333 0.43
334 0.46
335 0.52
336 0.54
337 0.49
338 0.51
339 0.55
340 0.62
341 0.66
342 0.71
343 0.69
344 0.72
345 0.74
346 0.71
347 0.68
348 0.66
349 0.6
350 0.53
351 0.5