Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6E1R0

Protein Details
Accession A0A5N6E1R0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
66-102ICDTRTRKPTCRKKIGEQWTSKKCLNKCTKGSCRFDPHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 25
Family & Domain DBs
Amino Acid Sequences MKTTLISVILLAAVATASAQPGGPHNTGVIPEIVVSPPSDGNGVGDKTVGPPDANKLGQSGMLYGICDTRTRKPTCRKKIGEQWTSKKCLNKCTKGSCRFDPSQPSEPADCSIPKQQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.03
4 0.03
5 0.04
6 0.04
7 0.05
8 0.08
9 0.13
10 0.14
11 0.14
12 0.14
13 0.15
14 0.15
15 0.16
16 0.13
17 0.08
18 0.08
19 0.08
20 0.08
21 0.08
22 0.08
23 0.08
24 0.07
25 0.08
26 0.08
27 0.07
28 0.08
29 0.1
30 0.1
31 0.09
32 0.09
33 0.09
34 0.09
35 0.1
36 0.1
37 0.07
38 0.07
39 0.1
40 0.14
41 0.14
42 0.13
43 0.12
44 0.12
45 0.13
46 0.12
47 0.1
48 0.07
49 0.07
50 0.07
51 0.06
52 0.07
53 0.07
54 0.09
55 0.11
56 0.16
57 0.25
58 0.29
59 0.37
60 0.47
61 0.58
62 0.67
63 0.75
64 0.74
65 0.75
66 0.81
67 0.83
68 0.82
69 0.8
70 0.79
71 0.76
72 0.75
73 0.7
74 0.66
75 0.59
76 0.6
77 0.61
78 0.61
79 0.62
80 0.67
81 0.74
82 0.77
83 0.81
84 0.78
85 0.76
86 0.71
87 0.69
88 0.68
89 0.65
90 0.64
91 0.6
92 0.57
93 0.51
94 0.49
95 0.44
96 0.38
97 0.33