Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179UK57

Protein Details
Accession A0A179UK57    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
123-142ERYLLRGTRQRKRVPQTPKKBasic
NLS Segment(s)
PositionSequence
133-142RKRVPQTPKK
Subcellular Location(s) mito 20, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR008386  ATP_synth_F0_esu_mt  
Gene Ontology GO:0000276  C:mitochondrial proton-transporting ATP synthase complex, coupling factor F(o)  
GO:0015078  F:proton transmembrane transporter activity  
GO:0015986  P:proton motive force-driven ATP synthesis  
KEGG bgh:BDBG_04236  -  
Pfam View protein in Pfam  
PF05680  ATP-synt_E  
Amino Acid Sequences MAASQGVNVLRYSALFAGVFYGLYHQSSLTSQAKQAQIDREYSRKESLIEQARAEYSKKNAPTETKTTSSGVITDPEDKRFDLEAFINMKSCRNGEIMNENVGGGGGGGRLMREALATRWLGERYLLRGTRQRKRVPQTPKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.1
4 0.1
5 0.1
6 0.1
7 0.08
8 0.1
9 0.09
10 0.1
11 0.1
12 0.08
13 0.09
14 0.1
15 0.17
16 0.18
17 0.18
18 0.19
19 0.25
20 0.28
21 0.29
22 0.32
23 0.32
24 0.3
25 0.34
26 0.36
27 0.35
28 0.36
29 0.37
30 0.35
31 0.3
32 0.29
33 0.26
34 0.31
35 0.34
36 0.33
37 0.3
38 0.29
39 0.29
40 0.29
41 0.28
42 0.22
43 0.17
44 0.2
45 0.22
46 0.23
47 0.25
48 0.28
49 0.32
50 0.36
51 0.37
52 0.34
53 0.33
54 0.32
55 0.3
56 0.25
57 0.21
58 0.16
59 0.13
60 0.11
61 0.15
62 0.15
63 0.16
64 0.17
65 0.17
66 0.18
67 0.17
68 0.17
69 0.13
70 0.13
71 0.15
72 0.16
73 0.16
74 0.17
75 0.16
76 0.17
77 0.17
78 0.16
79 0.14
80 0.13
81 0.14
82 0.14
83 0.2
84 0.2
85 0.21
86 0.21
87 0.19
88 0.17
89 0.16
90 0.13
91 0.07
92 0.05
93 0.03
94 0.03
95 0.03
96 0.04
97 0.04
98 0.04
99 0.04
100 0.05
101 0.07
102 0.08
103 0.12
104 0.13
105 0.14
106 0.17
107 0.17
108 0.17
109 0.19
110 0.2
111 0.19
112 0.27
113 0.28
114 0.3
115 0.38
116 0.46
117 0.53
118 0.6
119 0.66
120 0.67
121 0.74
122 0.79