Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6D7Z6

Protein Details
Accession A0A5N6D7Z6    Localization Confidence Low Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
412-431EKLCRAYFKHKEPKTFGSRFHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 15.5, cyto_nucl 13, nucl 5.5, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR003817  PS_Dcarbxylase  
Gene Ontology GO:0004609  F:phosphatidylserine decarboxylase activity  
GO:0008654  P:phospholipid biosynthetic process  
Pfam View protein in Pfam  
PF02666  PS_Dcarbxylase  
Amino Acid Sequences MAEYSEIVRELRDELLWEEDDLGQAVKNAHKWDIPELDKYGIISARGFLEFADWLVRGWVPTESTKGRDIYYILCVFYFVLSQEPLGSRLTKIQLLSLNKPLKPLSDWVVRFAKEIGSSMDKPSSINEAAITTFRNSPLFRVFESEGDAKNWTTFNKFFYRKLDNPRKIAGPDDDHIVVFPADSTFAGAYAISEDSEVVLQKKEWRVVKDEVILKNVPWKVKDLLGKYGDEKLPDDSSQTYGDVFKDGLWTHVFLNSFDYHRQHAPVSGTVEIIDVIEGAAYLEVLVQTDEQVGHNYLELCRQVAGKQRNPSGIRTLDAPDTPGYQFLQTRGVVMINNEYLGRVAVLPIGMAMVSSVNVRKELQGQKIKKGEEISHFAFGGSDCIIMFERKARVSGFPDSDPASREHFFYGEKLCRAYFKHKEPKTFGSRFGLPSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.19
3 0.19
4 0.18
5 0.18
6 0.17
7 0.17
8 0.16
9 0.14
10 0.1
11 0.11
12 0.14
13 0.15
14 0.19
15 0.21
16 0.23
17 0.25
18 0.27
19 0.32
20 0.38
21 0.38
22 0.38
23 0.38
24 0.37
25 0.36
26 0.34
27 0.3
28 0.23
29 0.21
30 0.17
31 0.15
32 0.16
33 0.16
34 0.15
35 0.11
36 0.12
37 0.11
38 0.11
39 0.12
40 0.1
41 0.1
42 0.11
43 0.12
44 0.1
45 0.11
46 0.12
47 0.12
48 0.14
49 0.2
50 0.22
51 0.25
52 0.29
53 0.29
54 0.28
55 0.27
56 0.27
57 0.23
58 0.27
59 0.26
60 0.22
61 0.2
62 0.2
63 0.18
64 0.17
65 0.15
66 0.08
67 0.09
68 0.09
69 0.09
70 0.11
71 0.11
72 0.13
73 0.14
74 0.14
75 0.13
76 0.18
77 0.2
78 0.21
79 0.2
80 0.23
81 0.27
82 0.31
83 0.35
84 0.39
85 0.43
86 0.4
87 0.43
88 0.4
89 0.35
90 0.32
91 0.32
92 0.28
93 0.31
94 0.31
95 0.34
96 0.39
97 0.37
98 0.35
99 0.33
100 0.29
101 0.2
102 0.21
103 0.19
104 0.2
105 0.21
106 0.22
107 0.23
108 0.21
109 0.21
110 0.21
111 0.23
112 0.18
113 0.17
114 0.15
115 0.14
116 0.14
117 0.15
118 0.15
119 0.11
120 0.12
121 0.13
122 0.16
123 0.15
124 0.17
125 0.22
126 0.22
127 0.21
128 0.24
129 0.24
130 0.22
131 0.26
132 0.26
133 0.22
134 0.21
135 0.22
136 0.17
137 0.17
138 0.17
139 0.14
140 0.16
141 0.16
142 0.19
143 0.27
144 0.3
145 0.31
146 0.37
147 0.44
148 0.46
149 0.56
150 0.63
151 0.6
152 0.61
153 0.61
154 0.57
155 0.5
156 0.47
157 0.4
158 0.32
159 0.27
160 0.26
161 0.24
162 0.2
163 0.19
164 0.17
165 0.12
166 0.08
167 0.07
168 0.04
169 0.04
170 0.04
171 0.05
172 0.04
173 0.04
174 0.05
175 0.04
176 0.04
177 0.05
178 0.05
179 0.04
180 0.04
181 0.04
182 0.04
183 0.05
184 0.06
185 0.05
186 0.06
187 0.06
188 0.11
189 0.13
190 0.18
191 0.22
192 0.23
193 0.28
194 0.3
195 0.32
196 0.33
197 0.37
198 0.33
199 0.33
200 0.31
201 0.25
202 0.29
203 0.28
204 0.24
205 0.19
206 0.21
207 0.19
208 0.23
209 0.28
210 0.24
211 0.28
212 0.28
213 0.28
214 0.27
215 0.3
216 0.26
217 0.22
218 0.21
219 0.17
220 0.17
221 0.16
222 0.16
223 0.13
224 0.14
225 0.13
226 0.13
227 0.11
228 0.1
229 0.11
230 0.1
231 0.09
232 0.07
233 0.09
234 0.09
235 0.1
236 0.1
237 0.11
238 0.1
239 0.13
240 0.13
241 0.11
242 0.14
243 0.14
244 0.15
245 0.16
246 0.18
247 0.18
248 0.19
249 0.2
250 0.17
251 0.19
252 0.19
253 0.2
254 0.2
255 0.18
256 0.17
257 0.15
258 0.15
259 0.12
260 0.09
261 0.06
262 0.04
263 0.03
264 0.03
265 0.03
266 0.03
267 0.02
268 0.02
269 0.02
270 0.02
271 0.03
272 0.03
273 0.03
274 0.03
275 0.04
276 0.05
277 0.05
278 0.06
279 0.08
280 0.09
281 0.09
282 0.1
283 0.11
284 0.1
285 0.13
286 0.13
287 0.12
288 0.12
289 0.12
290 0.14
291 0.22
292 0.3
293 0.33
294 0.4
295 0.43
296 0.5
297 0.52
298 0.52
299 0.49
300 0.43
301 0.37
302 0.33
303 0.31
304 0.26
305 0.24
306 0.23
307 0.17
308 0.18
309 0.18
310 0.17
311 0.15
312 0.15
313 0.16
314 0.15
315 0.19
316 0.17
317 0.18
318 0.17
319 0.17
320 0.15
321 0.15
322 0.17
323 0.12
324 0.13
325 0.12
326 0.11
327 0.1
328 0.1
329 0.09
330 0.06
331 0.06
332 0.06
333 0.06
334 0.06
335 0.05
336 0.05
337 0.04
338 0.04
339 0.04
340 0.03
341 0.04
342 0.06
343 0.08
344 0.09
345 0.11
346 0.12
347 0.13
348 0.22
349 0.29
350 0.37
351 0.45
352 0.48
353 0.55
354 0.61
355 0.61
356 0.56
357 0.54
358 0.5
359 0.47
360 0.51
361 0.45
362 0.41
363 0.4
364 0.36
365 0.32
366 0.26
367 0.21
368 0.14
369 0.11
370 0.08
371 0.09
372 0.11
373 0.11
374 0.12
375 0.15
376 0.2
377 0.2
378 0.23
379 0.23
380 0.27
381 0.31
382 0.38
383 0.37
384 0.34
385 0.36
386 0.37
387 0.37
388 0.34
389 0.32
390 0.3
391 0.26
392 0.26
393 0.25
394 0.23
395 0.23
396 0.25
397 0.31
398 0.32
399 0.33
400 0.34
401 0.33
402 0.36
403 0.4
404 0.47
405 0.48
406 0.52
407 0.61
408 0.65
409 0.73
410 0.76
411 0.8
412 0.8
413 0.75
414 0.7
415 0.66
416 0.65