Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q75CZ6

Protein Details
Accession Q75CZ6    Localization Confidence High Confidence Score 20.8
NoLS Segment(s)
PositionSequenceProtein Nature
6-38KKFTKESKVREIQKNLHKRAKLKRQYLKTLEQEHydrophilic
56-86RKGEKKQKVDEKKEHARRRKREQKEEMEAKRBasic
93-121LERAKVRQVERERRNKRIQQKTRSGQPKMHydrophilic
NLS Segment(s)
PositionSequence
19-28KNLHKRAKLK
48-116RQKPSFEQRKGEKKQKVDEKKEHARRRKREQKEEMEAKRQRELDELERAKVRQVERERRNKRIQQKTRS
Subcellular Location(s) nucl 21.5, cyto_nucl 11.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013730  Fyv7/TAP26  
IPR017265  Fyv7_fungi  
Gene Ontology GO:0005730  C:nucleolus  
GO:0032040  C:small-subunit processome  
GO:0000462  P:maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
KEGG ago:AGOS_ABR226W  -  
Pfam View protein in Pfam  
PF08524  rRNA_processing  
Amino Acid Sequences MVGVGKKFTKESKVREIQKNLHKRAKLKRQYLKTLEQEGYEVPEEQKRQKPSFEQRKGEKKQKVDEKKEHARRRKREQKEEMEAKRQRELDELERAKVRQVERERRNKRIQQKTRSGQPKMGPRINDLLDKIQKDTTYTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.74
3 0.78
4 0.77
5 0.8
6 0.83
7 0.81
8 0.8
9 0.76
10 0.74
11 0.77
12 0.79
13 0.79
14 0.78
15 0.79
16 0.79
17 0.84
18 0.82
19 0.8
20 0.75
21 0.72
22 0.62
23 0.53
24 0.45
25 0.36
26 0.32
27 0.24
28 0.19
29 0.14
30 0.17
31 0.19
32 0.24
33 0.3
34 0.34
35 0.35
36 0.37
37 0.45
38 0.52
39 0.6
40 0.63
41 0.65
42 0.66
43 0.75
44 0.79
45 0.8
46 0.75
47 0.69
48 0.69
49 0.71
50 0.73
51 0.71
52 0.71
53 0.71
54 0.75
55 0.8
56 0.8
57 0.8
58 0.8
59 0.79
60 0.83
61 0.85
62 0.84
63 0.85
64 0.85
65 0.84
66 0.83
67 0.84
68 0.77
69 0.77
70 0.71
71 0.63
72 0.58
73 0.51
74 0.42
75 0.36
76 0.35
77 0.3
78 0.36
79 0.35
80 0.33
81 0.33
82 0.33
83 0.32
84 0.33
85 0.29
86 0.28
87 0.37
88 0.45
89 0.53
90 0.64
91 0.68
92 0.72
93 0.81
94 0.81
95 0.82
96 0.82
97 0.83
98 0.82
99 0.86
100 0.85
101 0.86
102 0.86
103 0.8
104 0.75
105 0.72
106 0.72
107 0.7
108 0.68
109 0.59
110 0.54
111 0.57
112 0.53
113 0.5
114 0.43
115 0.42
116 0.43
117 0.43
118 0.41
119 0.38
120 0.36