Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6DB88

Protein Details
Accession A0A5N6DB88    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
6-34VRYQLLWRTKERKRNRRHRPSRHMSGAVAHydrophilic
NLS Segment(s)
PositionSequence
15-27KERKRNRRHRPSR
Subcellular Location(s) mito 13, plas 8, cyto 2, nucl 1, extr 1, pero 1, E.R. 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MLSLIVRYQLLWRTKERKRNRRHRPSRHMSGAVAIRFMAGQCGDSRIVRCHPDLILLVTRLGRGLNFMWLCSNLAAVIRLLFYIGSIRLWWNWIFRSLLLVTLLLLLQSLSPSEVSLCHTIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.62
3 0.7
4 0.73
5 0.79
6 0.86
7 0.89
8 0.91
9 0.94
10 0.95
11 0.95
12 0.94
13 0.93
14 0.9
15 0.81
16 0.7
17 0.65
18 0.58
19 0.47
20 0.38
21 0.27
22 0.19
23 0.16
24 0.16
25 0.11
26 0.06
27 0.06
28 0.06
29 0.09
30 0.1
31 0.11
32 0.13
33 0.14
34 0.17
35 0.18
36 0.19
37 0.18
38 0.17
39 0.18
40 0.17
41 0.16
42 0.14
43 0.12
44 0.12
45 0.11
46 0.11
47 0.09
48 0.09
49 0.06
50 0.06
51 0.06
52 0.11
53 0.11
54 0.11
55 0.12
56 0.12
57 0.13
58 0.11
59 0.11
60 0.06
61 0.06
62 0.06
63 0.06
64 0.05
65 0.05
66 0.05
67 0.05
68 0.04
69 0.04
70 0.05
71 0.05
72 0.06
73 0.06
74 0.07
75 0.08
76 0.1
77 0.11
78 0.13
79 0.14
80 0.16
81 0.17
82 0.16
83 0.2
84 0.17
85 0.18
86 0.16
87 0.14
88 0.12
89 0.11
90 0.11
91 0.07
92 0.07
93 0.05
94 0.04
95 0.05
96 0.05
97 0.05
98 0.06
99 0.06
100 0.07
101 0.08
102 0.12