Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6E1C8

Protein Details
Accession A0A5N6E1C8    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
51-80VRHFNHLPKERGKRKKRKIRAPRLQGCILYBasic
NLS Segment(s)
PositionSequence
58-73PKERGKRKKRKIRAPR
Subcellular Location(s) mito 13, nucl 9, cyto 2, pero 2, cyto_pero 2
Family & Domain DBs
Amino Acid Sequences MGDPRRGRLKSNFWCLQRTDAQGILLSCSFLAYSEHTRSFFSLCGAQVMLVRHFNHLPKERGKRKKRKIRAPRLQGCILYAQSLQYAAFPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.6
3 0.58
4 0.52
5 0.47
6 0.4
7 0.34
8 0.31
9 0.29
10 0.27
11 0.23
12 0.18
13 0.13
14 0.1
15 0.09
16 0.08
17 0.06
18 0.07
19 0.08
20 0.13
21 0.16
22 0.18
23 0.19
24 0.19
25 0.2
26 0.2
27 0.17
28 0.14
29 0.12
30 0.11
31 0.11
32 0.1
33 0.09
34 0.11
35 0.11
36 0.11
37 0.13
38 0.13
39 0.15
40 0.17
41 0.18
42 0.23
43 0.28
44 0.32
45 0.37
46 0.47
47 0.55
48 0.64
49 0.73
50 0.77
51 0.83
52 0.89
53 0.91
54 0.92
55 0.94
56 0.94
57 0.94
58 0.94
59 0.92
60 0.88
61 0.82
62 0.72
63 0.62
64 0.55
65 0.44
66 0.35
67 0.26
68 0.2
69 0.16
70 0.16
71 0.14