Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6D971

Protein Details
Accession A0A5N6D971    Localization Confidence Low Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
183-209KRVWECWQKRVNLRRKACRDLWRRCLEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, cyto_nucl 9.833, mito_nucl 9.333, cyto 6.5, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036388  WH-like_DNA-bd_sf  
Amino Acid Sequences MKEKGQSEKMPSNGTVNDGPTLVLDYLRKQNRPYSVCGVGRTYQANVSQLMAYRPQTFLQICTTTSPKVLRELHQSQKIEGRASGRQAVYHALQKGADESTLERVVVLDDHILQLQEQLTNLKGYAKNARAELATLRATPLAFDLQESINHLQVEKETAFAILTQAQGTSAGQVDEEDRTIAKRVWECWQKRVNLRRKACRDLWRRCLEMVDKDVTREELWV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.35
3 0.29
4 0.26
5 0.22
6 0.2
7 0.16
8 0.18
9 0.13
10 0.13
11 0.12
12 0.15
13 0.25
14 0.31
15 0.34
16 0.34
17 0.4
18 0.48
19 0.5
20 0.52
21 0.49
22 0.51
23 0.51
24 0.5
25 0.48
26 0.4
27 0.4
28 0.35
29 0.3
30 0.25
31 0.24
32 0.23
33 0.2
34 0.2
35 0.18
36 0.17
37 0.17
38 0.17
39 0.18
40 0.18
41 0.19
42 0.18
43 0.21
44 0.2
45 0.21
46 0.22
47 0.21
48 0.2
49 0.22
50 0.24
51 0.2
52 0.23
53 0.23
54 0.19
55 0.25
56 0.27
57 0.27
58 0.34
59 0.4
60 0.45
61 0.5
62 0.5
63 0.44
64 0.46
65 0.45
66 0.37
67 0.32
68 0.27
69 0.23
70 0.24
71 0.27
72 0.22
73 0.2
74 0.2
75 0.21
76 0.19
77 0.21
78 0.19
79 0.15
80 0.15
81 0.14
82 0.15
83 0.12
84 0.11
85 0.07
86 0.07
87 0.1
88 0.1
89 0.1
90 0.08
91 0.08
92 0.08
93 0.08
94 0.07
95 0.04
96 0.04
97 0.05
98 0.05
99 0.05
100 0.05
101 0.05
102 0.06
103 0.05
104 0.05
105 0.06
106 0.06
107 0.07
108 0.07
109 0.1
110 0.1
111 0.12
112 0.19
113 0.22
114 0.23
115 0.23
116 0.24
117 0.21
118 0.21
119 0.19
120 0.16
121 0.14
122 0.12
123 0.12
124 0.12
125 0.11
126 0.11
127 0.11
128 0.08
129 0.07
130 0.07
131 0.09
132 0.09
133 0.09
134 0.13
135 0.13
136 0.14
137 0.14
138 0.14
139 0.13
140 0.13
141 0.16
142 0.12
143 0.12
144 0.09
145 0.1
146 0.1
147 0.09
148 0.1
149 0.08
150 0.08
151 0.08
152 0.07
153 0.07
154 0.08
155 0.08
156 0.08
157 0.07
158 0.06
159 0.06
160 0.07
161 0.08
162 0.08
163 0.09
164 0.08
165 0.08
166 0.09
167 0.12
168 0.13
169 0.17
170 0.19
171 0.21
172 0.31
173 0.4
174 0.42
175 0.49
176 0.55
177 0.57
178 0.64
179 0.72
180 0.72
181 0.73
182 0.79
183 0.81
184 0.82
185 0.83
186 0.82
187 0.82
188 0.83
189 0.83
190 0.83
191 0.8
192 0.74
193 0.67
194 0.65
195 0.6
196 0.56
197 0.51
198 0.47
199 0.4
200 0.39
201 0.4
202 0.36