Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6DVB2

Protein Details
Accession A0A5N6DVB2    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
83-104AASNKNAKRREAKKKAKAAQEGHydrophilic
148-176EAENEKKARNLKKKLRQARDLRDKKNQGEBasic
NLS Segment(s)
PositionSequence
87-99KNAKRREAKKKAK
153-170KKARNLKKKLRQARDLRD
Subcellular Location(s) nucl 18.5, cyto_nucl 12.5, mito 4, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039333  PYM1  
IPR015362  WIBG_mago-bd  
IPR036348  WIBG_N_sf  
Gene Ontology GO:1903259  P:exon-exon junction complex disassembly  
Pfam View protein in Pfam  
PF09282  Mago-bind  
Amino Acid Sequences MASTNSGITTDAATGERYIPSSVRADGSKRREIRVRPGYRPPEDVELYKNRAAQAWKNRGNTGVPGAESLKNENESPAKTGTAASNKNAKRREAKKKAKAAQEGTATTEGKNVTEIDNWRAPASGADKKQSNGPDKAAGGAEETIDLEAENEKKARNLKKKLRQARDLRDKKNQGEALLPEQLEKVIKIQELIRQLDALGFDSNGDKKDDSAEKEEKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.13
4 0.13
5 0.14
6 0.13
7 0.16
8 0.17
9 0.18
10 0.19
11 0.21
12 0.25
13 0.33
14 0.39
15 0.46
16 0.46
17 0.51
18 0.55
19 0.58
20 0.63
21 0.65
22 0.66
23 0.63
24 0.7
25 0.73
26 0.69
27 0.68
28 0.6
29 0.56
30 0.51
31 0.45
32 0.41
33 0.39
34 0.4
35 0.39
36 0.37
37 0.31
38 0.32
39 0.34
40 0.36
41 0.4
42 0.46
43 0.51
44 0.52
45 0.52
46 0.51
47 0.48
48 0.42
49 0.35
50 0.27
51 0.19
52 0.18
53 0.2
54 0.2
55 0.19
56 0.2
57 0.18
58 0.18
59 0.18
60 0.18
61 0.18
62 0.17
63 0.19
64 0.18
65 0.16
66 0.14
67 0.15
68 0.16
69 0.21
70 0.22
71 0.22
72 0.29
73 0.32
74 0.38
75 0.41
76 0.41
77 0.44
78 0.52
79 0.61
80 0.63
81 0.71
82 0.74
83 0.8
84 0.83
85 0.81
86 0.78
87 0.7
88 0.64
89 0.57
90 0.48
91 0.4
92 0.36
93 0.28
94 0.22
95 0.2
96 0.15
97 0.12
98 0.12
99 0.1
100 0.08
101 0.11
102 0.12
103 0.14
104 0.16
105 0.17
106 0.16
107 0.15
108 0.15
109 0.14
110 0.17
111 0.19
112 0.19
113 0.22
114 0.23
115 0.24
116 0.28
117 0.32
118 0.33
119 0.3
120 0.3
121 0.29
122 0.28
123 0.29
124 0.25
125 0.19
126 0.14
127 0.12
128 0.1
129 0.07
130 0.07
131 0.06
132 0.05
133 0.05
134 0.04
135 0.06
136 0.07
137 0.08
138 0.09
139 0.09
140 0.13
141 0.21
142 0.3
143 0.39
144 0.48
145 0.58
146 0.67
147 0.78
148 0.85
149 0.87
150 0.87
151 0.87
152 0.87
153 0.88
154 0.87
155 0.84
156 0.83
157 0.82
158 0.75
159 0.74
160 0.65
161 0.55
162 0.51
163 0.47
164 0.41
165 0.38
166 0.34
167 0.25
168 0.23
169 0.23
170 0.19
171 0.16
172 0.14
173 0.13
174 0.14
175 0.15
176 0.17
177 0.21
178 0.26
179 0.28
180 0.27
181 0.24
182 0.24
183 0.23
184 0.22
185 0.19
186 0.14
187 0.11
188 0.11
189 0.14
190 0.16
191 0.16
192 0.18
193 0.16
194 0.16
195 0.23
196 0.29
197 0.31
198 0.37