Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A179UR94

Protein Details
Accession A0A179UR94    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
33-53SATKNRSKIRRLSRDRFRAHFHydrophilic
NLS Segment(s)
PositionSequence
38-48RSKIRRLSRDR
Subcellular Location(s) nucl 21, cyto_nucl 14, cyto 5
Family & Domain DBs
Amino Acid Sequences MEYDFERSHPSARLSTSGILNPNVNPSRWRSQSATKNRSKIRRLSRDRFRAHFLLHLSKRSDGKAERPAMR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.28
3 0.27
4 0.26
5 0.25
6 0.24
7 0.23
8 0.2
9 0.25
10 0.24
11 0.23
12 0.22
13 0.25
14 0.31
15 0.32
16 0.36
17 0.32
18 0.39
19 0.48
20 0.57
21 0.61
22 0.58
23 0.63
24 0.66
25 0.7
26 0.66
27 0.66
28 0.66
29 0.67
30 0.72
31 0.74
32 0.78
33 0.8
34 0.81
35 0.76
36 0.71
37 0.64
38 0.56
39 0.51
40 0.45
41 0.45
42 0.42
43 0.44
44 0.4
45 0.41
46 0.43
47 0.4
48 0.43
49 0.36
50 0.41
51 0.45