Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179UPW6

Protein Details
Accession A0A179UPW6   
Localization Confidence Medium
Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
111-134KGEKMKPGRKPGAKRGRKPKAAALBasic
NLS Segment(s)
PositionSequence
87-132KGAKTSTGPIKAKKEPSEEGGEDVKGEKMKPGRKPGAKRGRKPKAA
Subcellular Location(s) nucl 16, cyto_nucl 10.5, mito 7, cyto 3
Family & Domain DBs
KEGG bgh:BDBG_05806  -  
Amino Acid Sequences MADANNGPGDVADSKKKETDAIFIMECLKHLQTPARIDVSAVAKALKYKNPISVANRIREIRKQFNLQQHLTCSTNSANGGATTPRKGAKTSTGPIKAKKEPSEEGGEDVKGEKMKPGRKPGAKRGRKPKAAALEEDKPVKPATSGDNNEANSTAMEATA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.28
3 0.29
4 0.3
5 0.29
6 0.31
7 0.27
8 0.29
9 0.27
10 0.25
11 0.27
12 0.23
13 0.22
14 0.19
15 0.17
16 0.13
17 0.15
18 0.19
19 0.22
20 0.26
21 0.29
22 0.29
23 0.28
24 0.27
25 0.3
26 0.27
27 0.23
28 0.19
29 0.16
30 0.13
31 0.17
32 0.2
33 0.2
34 0.22
35 0.23
36 0.28
37 0.31
38 0.36
39 0.36
40 0.43
41 0.44
42 0.43
43 0.46
44 0.42
45 0.41
46 0.43
47 0.45
48 0.43
49 0.43
50 0.45
51 0.46
52 0.53
53 0.57
54 0.53
55 0.48
56 0.42
57 0.4
58 0.36
59 0.3
60 0.23
61 0.17
62 0.16
63 0.14
64 0.12
65 0.1
66 0.09
67 0.09
68 0.09
69 0.1
70 0.09
71 0.11
72 0.12
73 0.13
74 0.14
75 0.15
76 0.19
77 0.24
78 0.27
79 0.34
80 0.39
81 0.41
82 0.46
83 0.5
84 0.49
85 0.5
86 0.5
87 0.47
88 0.41
89 0.42
90 0.43
91 0.38
92 0.35
93 0.31
94 0.26
95 0.21
96 0.2
97 0.18
98 0.13
99 0.13
100 0.14
101 0.19
102 0.26
103 0.33
104 0.42
105 0.49
106 0.57
107 0.65
108 0.72
109 0.76
110 0.8
111 0.82
112 0.84
113 0.85
114 0.84
115 0.8
116 0.77
117 0.77
118 0.71
119 0.67
120 0.63
121 0.58
122 0.55
123 0.56
124 0.48
125 0.39
126 0.36
127 0.3
128 0.24
129 0.2
130 0.23
131 0.28
132 0.32
133 0.35
134 0.4
135 0.41
136 0.41
137 0.39
138 0.33
139 0.23
140 0.21