Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A179UCN2

Protein Details
Accession A0A179UCN2    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
270-296LPATPPCRGRGKKEKRSKKPEVIAAERBasic
NLS Segment(s)
PositionSequence
195-206KLRRVFRAERKR
277-289RGRGKKEKRSKKP
Subcellular Location(s) nucl 12.5, cyto_nucl 10.5, cyto 7.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007590  Saf4/Yju2  
Gene Ontology GO:0000398  P:mRNA splicing, via spliceosome  
KEGG bgh:BDBG_02085  -  
Pfam View protein in Pfam  
PF04502  Saf4_Yju2  
Amino Acid Sequences MQGFNMGRYVPPDQEGLTTGNKLANRHPLGSRARNLHTTGELTVRFEMPFAVWCSTCKPADSVLIGQGVRFNALKKRVGNYYSTPIYSFRMKHTVCGGWIEVRTDPKNTAYVVTEGGRRRDTGELDKGGYEEDGAITLRIPPGAVAGESAEKDAFAKLEGKVADQNRFMTEKARMEELRKKQERNWEDPYEQSRKLRRVFRAERKRRETAQGVTEALQDRMSLGIELLEESEGDRVRAGMVDFAPAGNNTVGGAVARRVISKPLFETKSLPATPPCRGRGKKEKRSKKPEVIAAERKLLLQKELSGNTRAAVDPFLVDDNSDWTPGVKRRKTNGSAAVVPPGDMDRSQERRKCDGIENKDGDSGDMSIAVNGNRPRELMATGADTETSTPRQVMSAIPLVGYEWSDDSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.23
3 0.22
4 0.22
5 0.21
6 0.21
7 0.23
8 0.24
9 0.25
10 0.28
11 0.35
12 0.36
13 0.39
14 0.4
15 0.44
16 0.51
17 0.57
18 0.59
19 0.55
20 0.56
21 0.57
22 0.57
23 0.52
24 0.46
25 0.4
26 0.35
27 0.33
28 0.29
29 0.27
30 0.26
31 0.24
32 0.21
33 0.19
34 0.18
35 0.13
36 0.16
37 0.17
38 0.17
39 0.17
40 0.18
41 0.22
42 0.26
43 0.26
44 0.23
45 0.22
46 0.22
47 0.25
48 0.27
49 0.25
50 0.23
51 0.26
52 0.25
53 0.23
54 0.24
55 0.2
56 0.19
57 0.17
58 0.17
59 0.2
60 0.26
61 0.31
62 0.32
63 0.36
64 0.41
65 0.42
66 0.45
67 0.43
68 0.45
69 0.42
70 0.4
71 0.37
72 0.31
73 0.32
74 0.33
75 0.3
76 0.27
77 0.34
78 0.33
79 0.35
80 0.38
81 0.37
82 0.32
83 0.33
84 0.3
85 0.24
86 0.25
87 0.24
88 0.21
89 0.24
90 0.25
91 0.24
92 0.24
93 0.22
94 0.24
95 0.22
96 0.22
97 0.18
98 0.18
99 0.18
100 0.18
101 0.22
102 0.23
103 0.26
104 0.25
105 0.24
106 0.25
107 0.26
108 0.28
109 0.29
110 0.32
111 0.3
112 0.3
113 0.3
114 0.27
115 0.24
116 0.2
117 0.14
118 0.08
119 0.06
120 0.05
121 0.05
122 0.05
123 0.05
124 0.06
125 0.06
126 0.06
127 0.06
128 0.05
129 0.06
130 0.06
131 0.06
132 0.05
133 0.06
134 0.07
135 0.08
136 0.08
137 0.07
138 0.07
139 0.07
140 0.07
141 0.07
142 0.06
143 0.08
144 0.08
145 0.12
146 0.12
147 0.13
148 0.18
149 0.21
150 0.23
151 0.22
152 0.23
153 0.21
154 0.23
155 0.22
156 0.19
157 0.21
158 0.21
159 0.21
160 0.24
161 0.23
162 0.27
163 0.35
164 0.4
165 0.47
166 0.48
167 0.49
168 0.49
169 0.58
170 0.59
171 0.57
172 0.57
173 0.51
174 0.47
175 0.49
176 0.51
177 0.47
178 0.43
179 0.42
180 0.4
181 0.41
182 0.46
183 0.49
184 0.49
185 0.54
186 0.61
187 0.67
188 0.72
189 0.76
190 0.8
191 0.8
192 0.79
193 0.71
194 0.68
195 0.62
196 0.54
197 0.48
198 0.4
199 0.34
200 0.29
201 0.29
202 0.24
203 0.19
204 0.15
205 0.11
206 0.09
207 0.08
208 0.08
209 0.05
210 0.04
211 0.04
212 0.04
213 0.04
214 0.04
215 0.04
216 0.04
217 0.04
218 0.06
219 0.06
220 0.06
221 0.06
222 0.06
223 0.06
224 0.07
225 0.06
226 0.07
227 0.07
228 0.08
229 0.08
230 0.08
231 0.08
232 0.07
233 0.09
234 0.06
235 0.06
236 0.05
237 0.05
238 0.05
239 0.05
240 0.05
241 0.04
242 0.06
243 0.07
244 0.08
245 0.08
246 0.13
247 0.14
248 0.15
249 0.18
250 0.25
251 0.26
252 0.26
253 0.29
254 0.28
255 0.34
256 0.33
257 0.31
258 0.28
259 0.3
260 0.35
261 0.38
262 0.39
263 0.42
264 0.44
265 0.52
266 0.58
267 0.66
268 0.7
269 0.75
270 0.81
271 0.83
272 0.9
273 0.91
274 0.9
275 0.86
276 0.83
277 0.8
278 0.78
279 0.76
280 0.68
281 0.62
282 0.53
283 0.46
284 0.42
285 0.35
286 0.27
287 0.2
288 0.21
289 0.23
290 0.26
291 0.28
292 0.27
293 0.26
294 0.25
295 0.25
296 0.21
297 0.17
298 0.14
299 0.11
300 0.09
301 0.1
302 0.11
303 0.09
304 0.09
305 0.08
306 0.11
307 0.12
308 0.12
309 0.11
310 0.1
311 0.16
312 0.23
313 0.33
314 0.36
315 0.42
316 0.49
317 0.6
318 0.63
319 0.66
320 0.68
321 0.64
322 0.62
323 0.57
324 0.55
325 0.45
326 0.4
327 0.32
328 0.24
329 0.2
330 0.15
331 0.18
332 0.21
333 0.29
334 0.38
335 0.41
336 0.46
337 0.51
338 0.54
339 0.55
340 0.56
341 0.58
342 0.58
343 0.64
344 0.61
345 0.56
346 0.56
347 0.51
348 0.42
349 0.33
350 0.26
351 0.16
352 0.14
353 0.12
354 0.1
355 0.12
356 0.11
357 0.16
358 0.18
359 0.21
360 0.2
361 0.2
362 0.22
363 0.22
364 0.23
365 0.19
366 0.18
367 0.19
368 0.19
369 0.19
370 0.17
371 0.16
372 0.16
373 0.18
374 0.18
375 0.16
376 0.15
377 0.16
378 0.16
379 0.17
380 0.17
381 0.19
382 0.23
383 0.21
384 0.21
385 0.2
386 0.2
387 0.2
388 0.18
389 0.14