Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A179UCR8

Protein Details
Accession A0A179UCR8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-20HFTSCSKNKNKNKNETGSVPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, cyto 8, mito_nucl 8
Family & Domain DBs
Amino Acid Sequences HFTSCSKNKNKNKNETGSVPVYNIIKQVFHTIERVYSADQTDKDTWVLNSEFSAHTISYKNLVLIVLQKINIILKVTDRLTALTTAIEKINISVEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.75
3 0.71
4 0.64
5 0.55
6 0.45
7 0.38
8 0.32
9 0.26
10 0.24
11 0.18
12 0.14
13 0.14
14 0.18
15 0.17
16 0.17
17 0.18
18 0.16
19 0.16
20 0.17
21 0.18
22 0.14
23 0.13
24 0.14
25 0.14
26 0.14
27 0.18
28 0.17
29 0.17
30 0.17
31 0.16
32 0.15
33 0.15
34 0.15
35 0.1
36 0.09
37 0.1
38 0.1
39 0.1
40 0.11
41 0.08
42 0.09
43 0.1
44 0.11
45 0.11
46 0.12
47 0.11
48 0.1
49 0.1
50 0.09
51 0.11
52 0.13
53 0.12
54 0.12
55 0.12
56 0.12
57 0.13
58 0.13
59 0.11
60 0.09
61 0.1
62 0.14
63 0.15
64 0.17
65 0.16
66 0.17
67 0.17
68 0.17
69 0.16
70 0.13
71 0.14
72 0.13
73 0.14
74 0.13
75 0.12
76 0.12