Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6DY45

Protein Details
Accession A0A5N6DY45    Localization Confidence Low Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
15-34LTSIFRRQCHRQLHSFTRRLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR011335  Restrct_endonuc-II-like  
IPR018828  RRG7  
IPR011856  tRNA_endonuc-like_dom_sf  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0003676  F:nucleic acid binding  
GO:0006310  P:DNA recombination  
GO:0006302  P:double-strand break repair  
Pfam View protein in Pfam  
PF10356  DUF2034  
Amino Acid Sequences MKLHRPFYPVLRLNLTSIFRRQCHRQLHSFTRRLFKLPSPPPHPSAHHHDLPSFLVYAERTSLSPTTTAYIGTHYEYIVQRTLRSSAFTLHRVGGRDDAGIDLVGTWHLPRREHPLRVIVQCKSLKTKLGPNLVRELEGTFNQSPVGWRTGDEVGILVSPREATKGVRDALARSSYPLMWMMIERDGALRQVLWNGKAEQLGLVNLGVEVRYSADEDADSSKGVVLTWDGEEIPNMEQVESHVSAVEDSWLRSWGGGFNGGQRNKSELLDAVQELFPEEKPLLFGTGECSTLTDADRVKVIHFLNSKSAQVEAASGMKHTST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.46
3 0.4
4 0.42
5 0.43
6 0.41
7 0.45
8 0.51
9 0.54
10 0.61
11 0.64
12 0.66
13 0.68
14 0.76
15 0.8
16 0.8
17 0.77
18 0.76
19 0.7
20 0.65
21 0.6
22 0.56
23 0.56
24 0.57
25 0.62
26 0.6
27 0.63
28 0.63
29 0.64
30 0.62
31 0.58
32 0.58
33 0.56
34 0.54
35 0.5
36 0.47
37 0.44
38 0.41
39 0.36
40 0.27
41 0.19
42 0.15
43 0.14
44 0.14
45 0.13
46 0.12
47 0.11
48 0.14
49 0.14
50 0.14
51 0.14
52 0.14
53 0.14
54 0.13
55 0.14
56 0.11
57 0.12
58 0.13
59 0.14
60 0.14
61 0.11
62 0.16
63 0.16
64 0.18
65 0.2
66 0.19
67 0.18
68 0.2
69 0.22
70 0.18
71 0.2
72 0.18
73 0.2
74 0.24
75 0.25
76 0.25
77 0.25
78 0.27
79 0.26
80 0.27
81 0.23
82 0.2
83 0.18
84 0.16
85 0.14
86 0.11
87 0.09
88 0.08
89 0.05
90 0.05
91 0.04
92 0.04
93 0.04
94 0.08
95 0.1
96 0.11
97 0.13
98 0.23
99 0.3
100 0.33
101 0.35
102 0.38
103 0.42
104 0.46
105 0.49
106 0.4
107 0.41
108 0.4
109 0.4
110 0.38
111 0.34
112 0.33
113 0.3
114 0.37
115 0.36
116 0.44
117 0.45
118 0.41
119 0.46
120 0.42
121 0.4
122 0.33
123 0.27
124 0.2
125 0.17
126 0.19
127 0.13
128 0.13
129 0.13
130 0.12
131 0.12
132 0.12
133 0.14
134 0.09
135 0.09
136 0.12
137 0.13
138 0.13
139 0.12
140 0.09
141 0.08
142 0.08
143 0.07
144 0.04
145 0.04
146 0.04
147 0.04
148 0.05
149 0.05
150 0.06
151 0.09
152 0.12
153 0.13
154 0.15
155 0.15
156 0.16
157 0.18
158 0.2
159 0.17
160 0.15
161 0.15
162 0.13
163 0.13
164 0.13
165 0.1
166 0.08
167 0.08
168 0.08
169 0.08
170 0.08
171 0.07
172 0.07
173 0.07
174 0.07
175 0.07
176 0.06
177 0.06
178 0.1
179 0.11
180 0.11
181 0.13
182 0.14
183 0.15
184 0.15
185 0.15
186 0.12
187 0.11
188 0.1
189 0.08
190 0.07
191 0.05
192 0.05
193 0.05
194 0.04
195 0.03
196 0.03
197 0.04
198 0.04
199 0.05
200 0.05
201 0.06
202 0.06
203 0.07
204 0.09
205 0.09
206 0.09
207 0.08
208 0.08
209 0.08
210 0.08
211 0.07
212 0.06
213 0.07
214 0.07
215 0.08
216 0.07
217 0.07
218 0.08
219 0.09
220 0.09
221 0.1
222 0.1
223 0.09
224 0.09
225 0.1
226 0.15
227 0.14
228 0.13
229 0.11
230 0.11
231 0.11
232 0.11
233 0.13
234 0.09
235 0.09
236 0.1
237 0.11
238 0.11
239 0.11
240 0.11
241 0.11
242 0.11
243 0.14
244 0.13
245 0.2
246 0.28
247 0.3
248 0.31
249 0.3
250 0.32
251 0.31
252 0.32
253 0.26
254 0.19
255 0.19
256 0.21
257 0.2
258 0.19
259 0.17
260 0.17
261 0.16
262 0.16
263 0.14
264 0.14
265 0.13
266 0.11
267 0.12
268 0.13
269 0.14
270 0.12
271 0.12
272 0.15
273 0.16
274 0.17
275 0.15
276 0.15
277 0.14
278 0.15
279 0.17
280 0.16
281 0.15
282 0.16
283 0.18
284 0.18
285 0.18
286 0.23
287 0.22
288 0.26
289 0.29
290 0.3
291 0.36
292 0.38
293 0.39
294 0.33
295 0.33
296 0.26
297 0.23
298 0.22
299 0.16
300 0.16
301 0.15
302 0.14