Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6D8L0

Protein Details
Accession A0A5N6D8L0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
65-90AEERRIRVLKKCQRDKEKEREERAAABasic
NLS Segment(s)
Subcellular Location(s) cyto 10.5, cyto_nucl 6.5, E.R. 4, extr 3, mito 2, plas 2, pero 2, golg 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MEEDNPCSLAFFLFAFWAGLLGLLRNRRTGTQENVTAIDAKINPLCLIVTLFVTLPEARMSRSAAEERRIRVLKKCQRDKEKEREERAAAW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.07
3 0.07
4 0.07
5 0.06
6 0.06
7 0.06
8 0.06
9 0.09
10 0.13
11 0.15
12 0.17
13 0.18
14 0.19
15 0.25
16 0.29
17 0.31
18 0.33
19 0.35
20 0.34
21 0.34
22 0.33
23 0.28
24 0.23
25 0.19
26 0.13
27 0.12
28 0.1
29 0.1
30 0.09
31 0.08
32 0.08
33 0.06
34 0.06
35 0.05
36 0.05
37 0.05
38 0.05
39 0.05
40 0.06
41 0.06
42 0.06
43 0.08
44 0.08
45 0.08
46 0.1
47 0.11
48 0.11
49 0.14
50 0.19
51 0.21
52 0.27
53 0.31
54 0.32
55 0.4
56 0.42
57 0.41
58 0.44
59 0.52
60 0.55
61 0.61
62 0.7
63 0.71
64 0.78
65 0.87
66 0.88
67 0.88
68 0.9
69 0.89
70 0.86
71 0.84