Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6DVE1

Protein Details
Accession A0A5N6DVE1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
20-41ISRSRNGCVPCRRKKCKFDEAQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23.5, cyto_mito 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
Amino Acid Sequences MIVCYTMYAPLPPRPRKTNISRSRNGCVPCRRKKCKFDEAQSQCIRCARTGAMCWFQKTPLRFRSMDTNKGIGSKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.56
3 0.62
4 0.68
5 0.71
6 0.72
7 0.74
8 0.75
9 0.73
10 0.72
11 0.69
12 0.63
13 0.6
14 0.6
15 0.6
16 0.63
17 0.69
18 0.73
19 0.76
20 0.82
21 0.82
22 0.82
23 0.8
24 0.76
25 0.77
26 0.73
27 0.73
28 0.68
29 0.6
30 0.51
31 0.45
32 0.39
33 0.28
34 0.25
35 0.17
36 0.17
37 0.2
38 0.23
39 0.28
40 0.29
41 0.31
42 0.3
43 0.32
44 0.35
45 0.35
46 0.38
47 0.37
48 0.41
49 0.4
50 0.42
51 0.5
52 0.51
53 0.56
54 0.52
55 0.49
56 0.44