Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6DAM0

Protein Details
Accession A0A5N6DAM0    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
3-27AWELTPPPPNKRKERREKEEDLNVVHydrophilic
NLS Segment(s)
PositionSequence
14-16RKE
Subcellular Location(s) nucl 16.5, cyto_nucl 12.5, cyto 5.5, mito 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MEAWELTPPPPNKRKERREKEEDLNVVEHRVRCRFSFVSPSLFCGFFSLLFSSFHPFVGYLYCSHVIFDG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.78
3 0.86
4 0.86
5 0.87
6 0.86
7 0.84
8 0.81
9 0.73
10 0.64
11 0.55
12 0.46
13 0.39
14 0.33
15 0.27
16 0.22
17 0.22
18 0.21
19 0.18
20 0.24
21 0.23
22 0.22
23 0.27
24 0.26
25 0.31
26 0.29
27 0.32
28 0.29
29 0.28
30 0.26
31 0.2
32 0.19
33 0.12
34 0.14
35 0.12
36 0.11
37 0.12
38 0.13
39 0.16
40 0.16
41 0.16
42 0.15
43 0.13
44 0.13
45 0.15
46 0.15
47 0.12
48 0.16
49 0.18
50 0.18