Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6D3Z7

Protein Details
Accession A0A5N6D3Z7    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
48-73MEIGCWRCKRRGKSTCSDRRTKKRREBasic
NLS Segment(s)
PositionSequence
66-73RRTKKRRE
Subcellular Location(s) nucl 15.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
Amino Acid Sequences MKGQLITSELFSLCLSSCSGSQRVNVAKKGQCVHDADNVRGKDGGEKMEIGCWRCKRRGKSTCSDRRTKKRRE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.09
4 0.11
5 0.13
6 0.16
7 0.17
8 0.17
9 0.22
10 0.29
11 0.32
12 0.34
13 0.36
14 0.36
15 0.4
16 0.41
17 0.37
18 0.34
19 0.32
20 0.31
21 0.32
22 0.31
23 0.28
24 0.32
25 0.3
26 0.27
27 0.24
28 0.22
29 0.19
30 0.18
31 0.19
32 0.13
33 0.14
34 0.14
35 0.17
36 0.2
37 0.18
38 0.24
39 0.3
40 0.35
41 0.42
42 0.5
43 0.54
44 0.63
45 0.7
46 0.71
47 0.75
48 0.81
49 0.84
50 0.83
51 0.86
52 0.85
53 0.87