Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179V2F7

Protein Details
Accession A0A179V2F7   
Localization Confidence Medium
Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
52-72KRDFKMIIISDKKKKKKKNKKBasic
NLS Segment(s)
PositionSequence
62-72DKKKKKKKNKK
Subcellular Location(s) nucl 15, cyto 10
Family & Domain DBs
Amino Acid Sequences NIKKTALLSEYINLLTAEMKPETADQKIWDFEAQIDLAEREQQKPFSEKTVKRDFKMIIISDKKKKKKKNKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.1
4 0.12
5 0.1
6 0.1
7 0.09
8 0.11
9 0.13
10 0.14
11 0.15
12 0.14
13 0.16
14 0.16
15 0.17
16 0.15
17 0.13
18 0.12
19 0.12
20 0.1
21 0.08
22 0.07
23 0.07
24 0.06
25 0.1
26 0.11
27 0.12
28 0.13
29 0.15
30 0.17
31 0.2
32 0.21
33 0.25
34 0.34
35 0.36
36 0.42
37 0.52
38 0.55
39 0.53
40 0.57
41 0.5
42 0.46
43 0.48
44 0.42
45 0.41
46 0.45
47 0.52
48 0.56
49 0.65
50 0.7
51 0.74
52 0.82