Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6DNS9

Protein Details
Accession A0A5N6DNS9    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
51-88EYKNAEEKKRKGKAKKYFLLPSHRKSRDKRNESKEHSVBasic
NLS Segment(s)
PositionSequence
53-81KNAEEKKRKGKAKKYFLLPSHRKSRDKRN
Subcellular Location(s) mito 15, nucl 12
Family & Domain DBs
Amino Acid Sequences MIPLTCLSIYCITPSHVLSGSRPRVRGTGFTIPRDAKPRWRDKLNDSYRPEYKNAEEKKRKGKAKKYFLLPSHRKSRDKRNESKEHSV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.19
4 0.19
5 0.21
6 0.3
7 0.37
8 0.38
9 0.39
10 0.37
11 0.38
12 0.38
13 0.38
14 0.35
15 0.36
16 0.36
17 0.37
18 0.4
19 0.39
20 0.4
21 0.42
22 0.37
23 0.35
24 0.4
25 0.48
26 0.49
27 0.53
28 0.53
29 0.54
30 0.64
31 0.62
32 0.63
33 0.58
34 0.58
35 0.56
36 0.55
37 0.5
38 0.42
39 0.38
40 0.38
41 0.41
42 0.46
43 0.51
44 0.56
45 0.64
46 0.7
47 0.76
48 0.76
49 0.8
50 0.79
51 0.81
52 0.82
53 0.8
54 0.8
55 0.78
56 0.79
57 0.77
58 0.75
59 0.75
60 0.75
61 0.75
62 0.73
63 0.78
64 0.78
65 0.8
66 0.83
67 0.82
68 0.85