Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6D4S2

Protein Details
Accession A0A5N6D4S2    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
77-106IEKVKKEYEERQKKKKDKSKEKKSDEESKKBasic
NLS Segment(s)
PositionSequence
66-107KKKKEEALAKEIEKVKKEYEERQKKKKDKSKEKKSDEESKKE
Subcellular Location(s) nucl 23, cyto_nucl 15
Family & Domain DBs
InterPro View protein in InterPro  
IPR013640  Vfa1  
Pfam View protein in Pfam  
PF08432  Vfa1  
Amino Acid Sequences MSGPFQNIYHLRRVADTAAKACYVCHKPSSSVMITPDNKDFFYVCPIHLKDRHFCSPIVDTEAEEKKKKEEALAKEIEKVKKEYEERQKKKKDKSKEKKSDEESKKEEKPSNTDKQEGNDEKERDNKIESLKNSAQSTSTSDDGPRIFALHKNFYQMRIDRLRNLEAAKRNRQRLQDPSFFPSVPSGGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.34
3 0.34
4 0.29
5 0.29
6 0.29
7 0.27
8 0.25
9 0.29
10 0.28
11 0.28
12 0.31
13 0.31
14 0.33
15 0.37
16 0.43
17 0.36
18 0.34
19 0.34
20 0.38
21 0.38
22 0.38
23 0.39
24 0.33
25 0.31
26 0.3
27 0.27
28 0.19
29 0.23
30 0.21
31 0.18
32 0.24
33 0.26
34 0.31
35 0.35
36 0.37
37 0.37
38 0.43
39 0.48
40 0.42
41 0.41
42 0.38
43 0.37
44 0.35
45 0.33
46 0.26
47 0.21
48 0.25
49 0.31
50 0.31
51 0.3
52 0.29
53 0.27
54 0.3
55 0.3
56 0.3
57 0.31
58 0.34
59 0.39
60 0.44
61 0.42
62 0.44
63 0.49
64 0.45
65 0.39
66 0.35
67 0.29
68 0.3
69 0.32
70 0.36
71 0.42
72 0.5
73 0.56
74 0.64
75 0.73
76 0.74
77 0.82
78 0.81
79 0.81
80 0.82
81 0.85
82 0.87
83 0.88
84 0.87
85 0.85
86 0.83
87 0.82
88 0.78
89 0.74
90 0.69
91 0.64
92 0.62
93 0.59
94 0.57
95 0.48
96 0.49
97 0.49
98 0.52
99 0.48
100 0.48
101 0.44
102 0.42
103 0.49
104 0.45
105 0.42
106 0.4
107 0.39
108 0.37
109 0.42
110 0.42
111 0.34
112 0.33
113 0.31
114 0.29
115 0.34
116 0.32
117 0.34
118 0.35
119 0.38
120 0.37
121 0.34
122 0.3
123 0.25
124 0.28
125 0.23
126 0.21
127 0.17
128 0.17
129 0.19
130 0.19
131 0.19
132 0.15
133 0.13
134 0.14
135 0.17
136 0.22
137 0.26
138 0.26
139 0.32
140 0.33
141 0.34
142 0.41
143 0.38
144 0.41
145 0.43
146 0.45
147 0.44
148 0.48
149 0.48
150 0.44
151 0.45
152 0.44
153 0.45
154 0.5
155 0.55
156 0.59
157 0.65
158 0.68
159 0.72
160 0.72
161 0.73
162 0.73
163 0.72
164 0.68
165 0.65
166 0.63
167 0.56
168 0.49
169 0.42