Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q75AR4

Protein Details
Accession Q75AR4   
Localization Confidence Medium
Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
48-78YEGQPAPQRKVRKRRTRTRKPKQVPKDAQGKBasic
NLS Segment(s)
PositionSequence
55-72QRKVRKRRTRTRKPKQVP
Subcellular Location(s) nucl 15, mito 8, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR019339  CIR_N_dom  
Gene Ontology GO:0005681  C:spliceosomal complex  
GO:0006397  P:mRNA processing  
GO:0008380  P:RNA splicing  
KEGG ago:AGOS_ADL144C  -  
Pfam View protein in Pfam  
PF10197  Cir_N  
Amino Acid Sequences MDLNLLKSWNPQLQKNRKKVYEAQQELLKSARKPADDGTSGGGLDWMYEGQPAPQRKVRKRRTRTRKPKQVPKDAQGKLQESLQTARSDAPEGTCSPDETAAARGGQQGAPVEVSAKSPAKAVAEARGGPGSSGVHGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.71
3 0.75
4 0.73
5 0.76
6 0.76
7 0.76
8 0.76
9 0.72
10 0.66
11 0.61
12 0.57
13 0.52
14 0.47
15 0.4
16 0.29
17 0.31
18 0.3
19 0.27
20 0.28
21 0.3
22 0.33
23 0.31
24 0.31
25 0.27
26 0.23
27 0.22
28 0.2
29 0.17
30 0.1
31 0.08
32 0.07
33 0.05
34 0.04
35 0.05
36 0.05
37 0.06
38 0.12
39 0.14
40 0.18
41 0.23
42 0.32
43 0.41
44 0.52
45 0.6
46 0.66
47 0.74
48 0.81
49 0.87
50 0.9
51 0.93
52 0.93
53 0.94
54 0.93
55 0.93
56 0.91
57 0.91
58 0.86
59 0.8
60 0.79
61 0.69
62 0.65
63 0.59
64 0.51
65 0.41
66 0.37
67 0.32
68 0.23
69 0.24
70 0.21
71 0.17
72 0.15
73 0.16
74 0.15
75 0.15
76 0.13
77 0.13
78 0.12
79 0.13
80 0.16
81 0.16
82 0.16
83 0.15
84 0.15
85 0.14
86 0.13
87 0.15
88 0.11
89 0.11
90 0.11
91 0.11
92 0.12
93 0.12
94 0.13
95 0.12
96 0.11
97 0.11
98 0.11
99 0.11
100 0.1
101 0.11
102 0.14
103 0.15
104 0.15
105 0.15
106 0.17
107 0.18
108 0.21
109 0.21
110 0.22
111 0.25
112 0.25
113 0.27
114 0.27
115 0.25
116 0.22
117 0.22
118 0.17