Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A179ULG2

Protein Details
Accession A0A179ULG2    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
57-76DFKVIIISDKKKKKEKKNEKBasic
NLS Segment(s)
PositionSequence
66-76KKKKKEKKNEK
Subcellular Location(s) nucl 17, cyto_nucl 14, cyto 9
Family & Domain DBs
Amino Acid Sequences MIQNIEKTALLSEYINLLTADMKPETADQKMQDFETQIDLTEKKQQKPFSEKTAEGDFKVIIISDKKKKKEKKNEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.1
4 0.09
5 0.09
6 0.09
7 0.11
8 0.09
9 0.09
10 0.09
11 0.11
12 0.13
13 0.14
14 0.16
15 0.14
16 0.17
17 0.18
18 0.18
19 0.17
20 0.15
21 0.14
22 0.15
23 0.14
24 0.11
25 0.12
26 0.12
27 0.12
28 0.2
29 0.24
30 0.26
31 0.31
32 0.35
33 0.4
34 0.48
35 0.52
36 0.51
37 0.53
38 0.49
39 0.48
40 0.52
41 0.47
42 0.39
43 0.36
44 0.27
45 0.21
46 0.2
47 0.16
48 0.11
49 0.15
50 0.22
51 0.3
52 0.39
53 0.47
54 0.57
55 0.67
56 0.76