Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A179UH60

Protein Details
Accession A0A179UH60    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
62-81QESKKKRQENLKKGDPRRAABasic
NLS Segment(s)
PositionSequence
65-80KKKRQENLKKGDPRRA
Subcellular Location(s) mito_nucl 10.666, nucl 10.5, cyto_nucl 9.833, mito 9.5, cyto 7
Family & Domain DBs
Amino Acid Sequences MFQETKVRPGIDLGVARGYSARADGAGDADNKGKVVGLPQALRQLARCSERSRLIVGVLAIQESKKKRQENLKKGDPRRAAQHGRTVRSTQHSNRVQRLELR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.21
3 0.21
4 0.19
5 0.17
6 0.12
7 0.11
8 0.09
9 0.06
10 0.07
11 0.07
12 0.08
13 0.1
14 0.1
15 0.1
16 0.12
17 0.11
18 0.11
19 0.11
20 0.09
21 0.07
22 0.08
23 0.11
24 0.12
25 0.13
26 0.15
27 0.19
28 0.19
29 0.19
30 0.19
31 0.18
32 0.18
33 0.21
34 0.22
35 0.2
36 0.24
37 0.27
38 0.27
39 0.26
40 0.22
41 0.19
42 0.18
43 0.16
44 0.13
45 0.1
46 0.09
47 0.07
48 0.07
49 0.12
50 0.13
51 0.2
52 0.26
53 0.29
54 0.35
55 0.46
56 0.58
57 0.63
58 0.7
59 0.74
60 0.77
61 0.78
62 0.82
63 0.77
64 0.7
65 0.67
66 0.67
67 0.64
68 0.58
69 0.64
70 0.61
71 0.6
72 0.6
73 0.55
74 0.51
75 0.51
76 0.55
77 0.51
78 0.54
79 0.58
80 0.62
81 0.67
82 0.67