Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179UGX3

Protein Details
Accession A0A179UGX3   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
71-91YTTLPKTKRGHKGRYGRNSLNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 10, cyto 3
Family & Domain DBs
Amino Acid Sequences MFRGWNMSACLRIYLLTRSRLHSCACNDARRNNAFAPGGYEEDLILGRLETRLRYRTEQFAKLDSHYSPLYTTLPKTKRGHKGRYGRNSLNSKTIPPPTETQNLHREQQSNNTL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.25
3 0.29
4 0.31
5 0.34
6 0.38
7 0.4
8 0.4
9 0.39
10 0.37
11 0.4
12 0.43
13 0.47
14 0.47
15 0.5
16 0.55
17 0.5
18 0.51
19 0.42
20 0.41
21 0.34
22 0.29
23 0.28
24 0.22
25 0.22
26 0.18
27 0.17
28 0.12
29 0.12
30 0.12
31 0.08
32 0.06
33 0.05
34 0.04
35 0.05
36 0.06
37 0.07
38 0.1
39 0.13
40 0.16
41 0.2
42 0.22
43 0.29
44 0.33
45 0.37
46 0.35
47 0.35
48 0.33
49 0.31
50 0.31
51 0.23
52 0.21
53 0.17
54 0.16
55 0.13
56 0.13
57 0.14
58 0.13
59 0.15
60 0.21
61 0.23
62 0.32
63 0.35
64 0.43
65 0.51
66 0.59
67 0.66
68 0.67
69 0.74
70 0.76
71 0.83
72 0.83
73 0.77
74 0.78
75 0.76
76 0.69
77 0.66
78 0.57
79 0.51
80 0.48
81 0.49
82 0.42
83 0.39
84 0.4
85 0.38
86 0.45
87 0.45
88 0.45
89 0.47
90 0.49
91 0.5
92 0.52
93 0.49
94 0.43