Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A179U8V0

Protein Details
Accession A0A179U8V0    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
14-33SLEREFKRVQQQQRRRRQSNHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 11.333, cyto 10.5, nucl 9, mito_nucl 8.999, mito 7.5
Family & Domain DBs
Amino Acid Sequences MPSVLAEKAEKALSLEREFKRVQQQQRRRRQSNGASERYRVGVGVGVGNFE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.31
3 0.29
4 0.34
5 0.34
6 0.36
7 0.41
8 0.44
9 0.5
10 0.52
11 0.62
12 0.68
13 0.78
14 0.85
15 0.79
16 0.77
17 0.77
18 0.75
19 0.75
20 0.74
21 0.72
22 0.64
23 0.62
24 0.58
25 0.5
26 0.41
27 0.3
28 0.21
29 0.15
30 0.13
31 0.15